Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56A18 Olfactory Receptor

Gene Symbol OR56A18
Organism Dog
Family 56
Subfamily A
Pseudo No
Location chr21:29,250,900-29,251,900 (+)
Aliases cOR56A18

Sequence information


Nucleotide sequence

ATGACAGCGCACCAAAATGGCACCACTTCAGTTGTGGTTTCAGACTTCCTCCTGAATTGT
TTAGTCAGGTCTCCCAGCTGGAAGTTCTGGTTGTCCCTGCCCCTAAGCTTCCTCTTCCTC
CTGGCCATGGGGGCCAATGGTGTTCTCCTGGTCACCATCCAGCTGGAGGCCTCTCTGCAT
GAGCCCATGTACTACCTGCTCAGCATCCTCTCTCTGCTGGACATCATCCTCTGCCTGACT
GTTATACCCAAGGTCCTGGCCATCTTCTGGTTTGATCTCAGGTCCATCAGCTTCTCTGCC
TGCTTCATTCAGATGTACATCATGAATTGCTTCCTTGGCATGGAGTCTTGCACATTCATG
GTCATGGCCTATGACCGCTATGTGGCCATCTGCCACCCACTGAGGTACTCTTCCATCATC
ACTGATCAATTTGTAGCTAGGGCTGCTATGTTTATTTTGGCGAGGAATGCACTTCTTACT
ATGTTCATTCCTATCCTCTCTGCCCAGCTCCATTATTGTGGAAAAAATATAATTGAGAAC
TGTATCTGTGCCAACCTCTCTGTGTCCAAGCTCTCCTGTGATAATGTTTTCCTTAACAAA
ATATACCAGTTAATTGTGGCCTGGACTCTTCTGGGCTCTGACCTAGTCCTCATCTTCCTC
TCGTATCTCTTCATCCTAAAAACTGTTCTTAGACTTAAGGCAAAAGGGGCAGCTGCCAAA
GCTCTGAGCACATGCGGGTCACACTTCATTCTCATCCTCTTCTTTAGCACCATCCTGCTG
GTTTTGGTTTTTACCCACATTGCCAAAAAAAAAGTTTCCCCTGATATTCCCATCTTACTT
AATGTCCTACACCATGTAATTCCTGCAGCTCTCAATCCCATTGTCTATGGGATACGAACC
CAGGAGATTAAAGAGGGAATTAGGAAATTACTGAGGAGGGTAACAGAGAGATTCAAG


Conceptual translation

MTAHQNGTTSVVVSDFLLNCLVRSPSWKFWLSLPLSFLFLLAMGANGVLLVTIQLEASLH
EPMYYLLSILSLLDIILCLTVIPKVLAIFWFDLRSISFSACFIQMYIMNCFLGMESCTFM
VMAYDRYVAICHPLRYSSIITDQFVARAAMFILARNALLTMFIPILSAQLHYCGKNIIEN
CICANLSVSKLSCDNVFLNKIYQLIVAWTLLGSDLVLIFLSYLFILKTVLRLKAKGAAAK
ALSTCGSHFILILFFSTILLVLVFTHIAKKKVSPDIPILLNVLHHVIPAALNPIVYGIRT
QEIKEGIRKLLRRVTERFK