Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56A3 Olfactory Receptor

Gene Symbol OR56A3
Organism Dog
Family 56
Subfamily A
Pseudo No
Location chr21:29,285,000-29,285,900 (+)
Aliases cOR56A20

Sequence information


Nucleotide sequence

ATGACACCTCACAGAAATGGCTCCACTGGGGTTTCAGAGTTCCTCCTGAATTGTTTTGTC
AGGTCCCCCACTTGGCAGCTCTGGTTATCCCTGCCCCTCAGCATCTTGTTCCTTGTGGCC
ATGGGGGCCAATGCTGTTCTCCTGATCACCATCTGGCTGGAGGCCTCTCTACACCAGCCC
ATGTACTACCTGCTCAGCCTCCTCTCCCTCCTGGACATTGTTCTCTGCCTCACTGTCATC
CCCAAGGTCCTGGTCATCTTCTGGTTTGACCTCAAGTCCATCAGCTTTGATGCCTGCTTC
CTACAGATGTACATCATTAATTGTTTCTATGCCATGGAGTCCTGCACATTTATGGTCATG
GCCTATGACCGCTATGTGGCCATCTGCCACCCACTGAGGTACCCATCAATCATCACTGAA
CGATTTGTAGCTAAGGCTGCTGCCTTTATTTTGGCCAGAAATGGGATTGTAACAGTGACT
CTCCCCATTCTATCATCTCGACTCAATTATTGTGGGAGAAATATTATTGAGAATTGCATT
TGCGCCAATTTGTCTGTCTCCAAGCTCTCCTGTGATGATGTCACCATCAATCGCATTCTC
CAATTTGCTGGAGGCTGGACACTGCTAGGATCTGACCTCATCCTCATCTTCCTCTCCTAC
GGCCTTATACTCCGAGCTGTGCTGAGACTCAAGGCAGAGGGTGCCATGGCCAAGGCCCTG
AGCACATGTGGTTCTCACTTCATCCTTATCCTCTTCTTCAGCACCGTCCTTCTGGTCTTC
GTGCTCACTCATATGATGAAGAAGAAAGTCTCCCCTGATGTGCCAGTCTTGCTCAATGTC
CTCCACAATGTCATCCCCGCAGCCCTCAACCCCATTGTTTATGGAGTGCGAACCCAGGAG
ATCAAGCAAGGAATCCAGAGATTACTGAAGAAGGGGTGG


Conceptual translation

MTPHRNGSTGVSEFLLNCFVRSPTWQLWLSLPLSILFLVAMGANAVLLITIWLEASLHQP
MYYLLSLLSLLDIVLCLTVIPKVLVIFWFDLKSISFDACFLQMYIINCFYAMESCTFMVM
AYDRYVAICHPLRYPSIITERFVAKAAAFILARNGIVTVTLPILSSRLNYCGRNIIENCI
CANLSVSKLSCDDVTINRILQFAGGWTLLGSDLILIFLSYGLILRAVLRLKAEGAMAKAL
STCGSHFILILFFSTVLLVFVLTHMMKKKVSPDVPVLLNVLHNVIPAALNPIVYGVRTQE
IKQGIQRLLKKGW