Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56A3D Olfactory Receptor

Gene Symbol OR56A3D
Organism Dog
Family 56
Subfamily A
Pseudo No
Location chr21:29,261,200-29,262,200 (+)
Aliases cOR56A21P, cOR56A10

Sequence information


Nucleotide sequence

ATGACAGCACATCCAAATGGTACAATCTCCATTGAGGTTTCAGACTTCCTCCTGAATTGT
TTTGTCAGGTCTCCCAGCTGGAAGCTCTGGTTGTCCCTGCCCCTAAGCTTCCTCTTCCTC
CTGGCCATGGGGGCGAATAGTGTTCTCTTGGTCACCATCCAGCTAGAGGCCTCTCTTCAT
GAGCCCATGTACTACCTGCTGAGCCTCCTTTCCCTGTTAGACATTGTTGTCTGCCTCACT
GTCATCCCCAAGGTCCTGGCCATCTTCTGGTTTGACCTCAAGTCCATCAACTTCTATGCC
TGCTTTATCCAGATGTACATCATGAATTGCTTCCTTTCCATGGAGTCTTGCACATTCATG
GTCATGGCCTATGACCGCTATGTGGCCATCTGCCACCCACTGAGGTACCCATCCATCATC
ACAGAACAATTTGTAGCTAAGGCTGCTGCCTTTATTTTGGCCAGAAATGGGATTTTAACA
GTGCCTATCCCAATTCTATCATCCCGACTCAATTATTGTGGGAGAAATGTCATTGAGAAT
TGCATCTGTGCCAATATGTCTGTCTCCAAACTCTCCTGTGATGATGTCACCATCAATCGC
CTTTACCAGTTTGCTGTAGGATGGACACTGCTAGGATCTGACCTCATCCTCATCTTCCTC
TCCTACAGCCTCATACTGCGAGCTGTGCTGGGACTCAAGGCAGAGGGTGCTATGGCCAAG
GCCCTGAGCACATGTGGTTCTCATTTCATCCTTATCCTCTTCTTCAGCACCATCCTTCTG
GTCTTCGTGCTCACTCTTGTGGTGAAGAAGAAAGTCTCCCCTGATGTGCCAGTCTTGCTC
AATATCCTCCATCATGTCATCTTCTCAGCCCTCAACCCCATTGTTTATGGAGTGCGAACT
CAGGAGATCAAGCAAGGAATCCAGAGATTACTGAAGAAAGGATGG


Conceptual translation

MTAHPNGTISIEVSDFLLNCFVRSPSWKLWLSLPLSFLFLLAMGANSVLLVTIQLEASLH
EPMYYLLSLLSLLDIVVCLTVIPKVLAIFWFDLKSINFYACFIQMYIMNCFLSMESCTFM
VMAYDRYVAICHPLRYPSIITEQFVAKAAAFILARNGILTVPIPILSSRLNYCGRNVIEN
CICANMSVSKLSCDDVTINRLYQFAVGWTLLGSDLILIFLSYSLILRAVLGLKAEGAMAK
ALSTCGSHFILILFFSTILLVFVLTLVVKKKVSPDVPVLLNILHHVIFSALNPIVYGVRT
QEIKQGIQRLLKKGW