Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56A4C Olfactory Receptor

Gene Symbol OR56A4C
Organism Dog
Family 56
Subfamily A
Pseudo No
Location chr21:29,308,600-29,309,600 (-)
Aliases cOR56A8, cOR56A24

Sequence information


Nucleotide sequence

ATGATCAGAACACTTTACATGGCACCACCCAGCAACTACTCCACTGCTCCAGTTTCTGAA
TTCTTCCTCATCTGCTTCCCTAACTACCAGAGTTGGCAGCACTGGCTGTCCCTGCCCCTC
AGCCTCCTCTTCCTCCTGGCCATGGGGGCCAACGCCACCCTCTTGATTACTATCCGGCTG
GAGGCCTCTCTGCATGAGCCCATGTACTACCTGCTTGGCCTCCTCTCCCTGCTGGACATC
GTGCTCTCCCTCACTGTCATCCCCAAGGTCCTGGCCATCTTCTGGTTTGATCTGAGGTCT
ATCAGCTTCTCTGCCTGCTTCCTCCAGATGTTCATCATGAACAGTTTCCTCCCCATGGAG
TCCTGCACATTCATGGTCATGGCCTATGACCGCTATGTGGCCATCTGCCACCCATTACGA
TACTCATCTATCATTACTGACCAATTTGTAGTTAGGGCTGCCATCTTTGTTGTGGCCCGG
AATGGCCTTCTTACTATGCCTATCCCCATACTTTCTTCCCGGCTCAGATACTGTGCAGAG
AACATCATCAAGAACTGTATCTGTACTAACTTGTCTGTATCCAAACTTTCCTGTGATGAC
ATCACCTTCAATCAACTCTACCAGTTCGTGGCAGGCTGGACTCTACTGGGCTCTGACCTC
ATCCTAATTATTCTGTCCTACTCCTTCATCCTGAAAGCTGTGCTAAGGATCAAGGCTGAG
GGTGCTATGGCCAAAGCTCTAGGCACTTGTGGTTCTCACTTCATCCTCATCCTCTTCTTT
AGCACAGTCCTGTTGGTTCTAGTCATCACTAACCTGGCCAGGAAGAGAATTCCCCCAGAT
GTCCCCATCTTGCTCAACATCTTGCACCACCTCATCCCCCCAGCTCTGAACCCCATTGTT
TATGGTGTGAGAACCAAGGATATCAAGCAAGGAATCCAGAAGCTACTTAGAAGATTG


Conceptual translation

MIRTLYMAPPSNYSTAPVSEFFLICFPNYQSWQHWLSLPLSLLFLLAMGANATLLITIRL
EASLHEPMYYLLGLLSLLDIVLSLTVIPKVLAIFWFDLRSISFSACFLQMFIMNSFLPME
SCTFMVMAYDRYVAICHPLRYSSIITDQFVVRAAIFVVARNGLLTMPIPILSSRLRYCAE
NIIKNCICTNLSVSKLSCDDITFNQLYQFVAGWTLLGSDLILIILSYSFILKAVLRIKAE
GAMAKALGTCGSHFILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIV
YGVRTKDIKQGIQKLLRRL