Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56A6P Olfactory Receptor

Gene Symbol OR56A6P
Organism Dog
Family 56
Subfamily A
Pseudo Yes
Location chr21:29,108,500-29,109,400 (-)
Aliases cOR56A6P

Sequence information


Nucleotide sequence

ATGACAGCACACCAAAATGGCACCATCTCCACTGGGGCTTCAGAGTTTCTCCTGAATTGT
TTTGTCAGGTCCCCCACTTGGCAGCTCTGGTTATCCCTGCCCCTCGGCCTCTTGTTCCTC
GTGGCCATGGGGGCCAATGGTGTTCTCCTGATCACCATCTGGCTGGAGGCCTCTCTACAC
CAGCCCCTGTACTACCTGCTGAGCCTCCTCTCCCTCCTGGACATTGTTCTCTGCCTCACT
GTCATCCCCAAGGTCCTGGCCATCTTTTGGTTTGACCTCAAGTCCATCAGCTTTGATGCC
TGCTTCTTACAGATGTTCATCATGAATTTCTTCTATGCCATGGAGTCCTGCACATTCATG
GTCATGGCCTATGACCGCTATGTGGCCATCTGCCACCCACTGAGGTACCCATCCATCATA
CAGAACAATTTGTAGCTAAGGCTGCCATTTTTATTTTGGCCAGGAATGCTATTTCTACAT
TGCCTATCCCCATTCTCTCATCCAGACTCCATTATTGTGGGAGAAATGTCATTGAGAATT
GCATCTGTGCCAATATGTCTGTCTCCAAGCTCTCCTGTGATGATGTCACCATCAATCGTC
TCTACCAGTTTGCTGGAGGCTGGACACTGCTAGGATCTGACCTCGTCCTCATCTTCATCT
CTTACAGCCTCATACTTCAAACTGTGATGGGATTAAAGGCGGAGGGTGCTATGGCCAAAG
CCCTGAGCACATGTGGTTCTCACTTCATCCTTATCCTCTTCTTCAGCACCGTCCTTCTGG
TCTTTGTGCTCACTCATATGGTGACAAAGAAGGTGTCTCCACCATTGAGCAAGATGTTCC
AGTTTTGCTCAATGTCCTCCACCATGTCATCCCTGCAGCCTTGAACCCCATTGTTTATGG
AGTGCACACCCAGGAGATCAAACAAGGAATCCAGAGATTACTGAAG


Conceptual translation

MTAHQNGTISTGASEFLLNCFVRSPTWQLWLSLPLGLLFLVAMGANGVLLITIWLEASLH
QPLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLKSISFDACFLQMFIMNFFYAMESCTFM
VMAYDRYVAICHPLRYPSIIQNNL*LRLPFLFWPGMLFLHCL/PILSSRLHYCGRNVIE
NCICANMSVSKLSCDDVTINRLYQFAGGWTLLGSDLVLIFISYSLILQTVMGLKAEGAMA
KALSTCGSHFILILFFSTVLLVFVLTHMVTKKVSPPLSKMFQFCSMSSTMS/PAALNPI
VYGVHTQEIKQGIQRLLK