Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56B2 Olfactory Receptor

Gene Symbol OR56B2
Organism Dog
Family 56
Subfamily B
Pseudo No
Location chr21:28,902,700-28,903,600 (+)
Aliases cOR56B2

Sequence information


Nucleotide sequence

ATGTTCCAGGATCTTAGACATTCCAACATCTCTAAGTTCCAGGTCTCTGAGTTCATTCTG
ATGGGATTCCCAGGCATTCACACCTGGCAACACTGGCTCTCCCTGCCCCTGGCACTACTT
TACCTCTTAGCTCTCACTGCCAACATCCTTATCCTGATTATCATCAAACAAGAGGCTACA
CTGCACCAGCCTATGTACTATTTCTTGGGGATCCTGGCTGTGGTAGACATGGGACTGGCT
ACCACCATCATGCCCAAGATTTTGGCCATCTTATGGTTCAGTGCAAAGGCCATCAGTCTC
CCTGAGTGCTTTGCTCAGATGTATGTCATACATTGTTTTGTGGCCATGGAGTCAGGTATC
TTTGTCTGCATGGCTATAGACAGATATGTAGCCATTTGCCAACCACTACGTTATCCATCA
ATAGTTACTGATTCTTTTGTCGTCAAGGCAACTGTGTTCATGGCACTCAGAAACAGTCTG
GCCACCATCCCAGTGCCAGTGTTGGCTGCTCAGAGGCACTACTGTTCCAAGAACCAAATT
GAGCATTGCCTATGCTCTAATCTTGGAGTCACTAGGTTATCCTGTGATGACAGGACAATC
AACAGCATCTACCAGGTTCTTTTGGCCTGGACACTGATGGGGAGTGACCTGGGTTTGATT
TTCTTATCATATGCTTTGATACTTCACTCAGTGCTGAAGCTGAATTCAGCAGAAGCTGCA
TCCAAAGCCCTAAGTACCTGTACTTCTCACCTCATTCTAATCCTGTTCTTCTACTCAGTT
ATTATAGTCATTTCCATCACCCACAGTGCAACAATGACTCTTCCTCTCATCCCAGTTCTG
CTTAATGTACTACATAATGTTATTCCTCCTGCCCTTAACCCTATGGTATATGCACTCAAG
AACAAGGACCTCAGGCAGGGCTTCTATAAGGTTCTGAATCTGTACAACAAAGGTAAT


Conceptual translation

MFQDLRHSNISKFQVSEFILMGFPGIHTWQHWLSLPLALLYLLALTANILILIIIKQEAT
LHQPMYYFLGILAVVDMGLATTIMPKILAILWFSAKAISLPECFAQMYVIHCFVAMESGI
FVCMAIDRYVAICQPLRYPSIVTDSFVVKATVFMALRNSLATIPVPVLAAQRHYCSKNQI
EHCLCSNLGVTRLSCDDRTINSIYQVLLAWTLMGSDLGLIFLSYALILHSVLKLNSAEAA
SKALSTCTSHLILILFFYSVIIVISITHSATMTLPLIPVLLNVLHNVIPPALNPMVYALK
NKDLRQGFYKVLNLYNKGN