Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56B2C Olfactory Receptor

Gene Symbol OR56B2C
Organism Dog
Family 56
Subfamily B
Pseudo No
Location chr21:28,912,900-28,913,800 (+)
Aliases cOR56B10, cOR56B7

Sequence information


Nucleotide sequence

ATGCTCCAGGATCTTGGACATTCCAACATCTCGAAGTCCCAAGTCTCTGAGTTCATTCTG
TTGGGATTCCCAGGCATTCACACCTGGCAGCACTGGCTCTCCCTGCCCCTGGCACTGCTT
TACCTCTTAGCTCTCACTGCCAACATCCTTATCCTGATCATCATCAAACAAGAGGCCACA
CTGCACCAGCCTATGTACTATTTTTTGGGGATCCTGGCTGTGGTAGACATGGGACTGGCT
ACCACCATCATGCCCAAGATTTTGGCCATCTTATGGTTTAGTGCAAAGGCCATCAGTCTC
CCTGAGTGCTTTGCTCAGATGTATGTCATACATTGTTTTGTGGGCATGGAGTCAGGTATC
TTTGTCTGCATGGCTATAGACAGATATGTAGCCATTTGCCAACCACTACGCTATCCATCA
ATAGTTACTGATTCTTTTGTCGTCAAGGCAACTGTGTTCATGGCACTCAGAAACAGTCTG
GCCACCATCCCAGTGCCAATGTTGGCTGCTCAGAGGCACTACTGTTCCAAGAACCAAATT
GAGCATTGCCTATGCTCTAATCTTGGAGTCACTAGGTTATCCTGTGATGACAGGACAATC
AACAGCATCTACCAGCTGTTTCTTGCCTGGACACTGATGGGGAGTGACCTGGGTTTGATT
TTCTTATCATATGCTCTGATACTTCACTCAGTGCTGAAGCTGAATTCAGCAGAAGCTGCA
TCCAAAGCCCTAAGTACCTGTACTTCTCACCTCATTCTAATCCTGTTCTTCTACACAGTT
GTCATTGTTATTTCCATTACCCACAGTGCAACAATGACTCTTCCCCTCATCCCAGTTCTG
CTTAATGTACTACACAATGTTATTCCTCCTGCCCTTAACCCTATGGTATATGCACTCAAG
AACAAGGAGCTCAGGCAGGGCTTCTATAAGATTCTGAAGCTGGACAACAAGGGTAAC


Conceptual translation

MLQDLGHSNISKSQVSEFILLGFPGIHTWQHWLSLPLALLYLLALTANILILIIIKQEAT
LHQPMYYFLGILAVVDMGLATTIMPKILAILWFSAKAISLPECFAQMYVIHCFVGMESGI
FVCMAIDRYVAICQPLRYPSIVTDSFVVKATVFMALRNSLATIPVPMLAAQRHYCSKNQI
EHCLCSNLGVTRLSCDDRTINSIYQLFLAWTLMGSDLGLIFLSYALILHSVLKLNSAEAA
SKALSTCTSHLILILFFYTVVIVISITHSATMTLPLIPVLLNVLHNVIPPALNPMVYALK
NKELRQGFYKILKLDNKGN