Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56B2D Olfactory Receptor

Gene Symbol OR56B2D
Organism Dog
Family 56
Subfamily B
Pseudo No
Location chr21:28,922,200-28,923,200 (+)
Aliases cOR56B5

Sequence information


Nucleotide sequence

ATGCTCCAGGATCTTGGACATTCCAACATCTCGAAGTCCCAAGTCTCTGAGTTCATTCTG
ATGGGATTCCCAGGCATTCACACCTGGCAGCACTGGCTCTCCCTGCCCCTGGCACTACTT
TACCTCTTAGCTCTCACTGCCAACATCCTTATCCTGATCATCATCAAACAAGAGGCCACA
CTGCACCAGCCTATGTACTATTTTTTGGGGATCCTGGCTGTGGTAGACATGGGACTGGCT
ACCACCATCATGCCCAAGATTTTGGCCATCTTATGGTTCAGTGCAAAGGCCATTGGTCTC
CCTGAATGCTTTGCTCAGATGTATGTCATACATTGTTTTGTACTCATGGAGTCAGGTATC
TTTGTCTGCATGGCTATAGACAGATATGTAGCCATTTGCCAACCACTACGCTATCCATCA
ATAGTTACTGATTCTTTTGTCGCCAAGGCAACTGTGTTTATGGCACTCAGAAACAGTCTG
GCTACCATCCCAGTGCCAGTGTTGGCCGCTGAGAGGCACTACTGTTCCAAGAACCAAATT
GAGCATTGCCTATGCTCTAATCTTGGAGTCACTAGGTTATCCTGTGATGACAGAACCATC
AACAGCATCTACCAGCTATTTCTTGCCTGGACACTGATGGGGAGTGACCTGGGTTTGATT
TTTTTATCATATGCTTTGATACTCCACTCAGTGCTGAAGCTGAATTCAGCAGAAGCTGCA
TCCAAAGCCCTAAGTACCTGTACTTCCCATCTCATCCTAATTTTATTCTTTTACACTGTC
ATTGTTGTCATTTCTATTACCCACAGTGCAACAATGACTCTTCCCCTCATCCCAGTTCTG
CTTAATGTACTACACAATGTTATTCCTCCTGCCCTCAATCCCATAGTGTATGCATTCAAA
AACAAGGAGCTCAGGCAGGGCTTCTATAAGGCTCTTAAGCTGAATATCAAGGGCAAC


Conceptual translation

MLQDLGHSNISKSQVSEFILMGFPGIHTWQHWLSLPLALLYLLALTANILILIIIKQEAT
LHQPMYYFLGILAVVDMGLATTIMPKILAILWFSAKAIGLPECFAQMYVIHCFVLMESGI
FVCMAIDRYVAICQPLRYPSIVTDSFVAKATVFMALRNSLATIPVPVLAAERHYCSKNQI
EHCLCSNLGVTRLSCDDRTINSIYQLFLAWTLMGSDLGLIFLSYALILHSVLKLNSAEAA
SKALSTCTSHLILILFFYTVIVVISITHSATMTLPLIPVLLNVLHNVIPPALNPIVYAFK
NKELRQGFYKALKLNIKGN