Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56B6 Olfactory Receptor

Gene Symbol OR56B6
Organism Dog
Family 56
Subfamily B
Pseudo No
Location chr21:29,391,300-29,392,300 (+)
Aliases cOR56B6, cOR56B13

Sequence information


Nucleotide sequence

ATGGATATCACCCTGAGTATAACCAATAGCTCCAGGTTTCAAGTACCTGAATTCATCCTC
CTGGGGCTCCCAGGCATTCATGAGTGGCAGCACTGGCTCTCTCTGCCCCTGGCTCTGCTC
TACATCTTAGCTCTTTGTGCCAACATCCTCATCTTAATCACCATCCAACATGAGCCTTCC
CTGCACCAGCCCATGTATTGGTTCCTTGGTGTCTTGGCTATAGTGGACATTGGCCTGGCT
ACCACTATCATACCCAAGATCCTGGCCATTCTCTGGTTTGATGCCAAGGCCATCAGCCTC
CCTGAGTGCTTTGCTCAGATCTATGCCATCCACTCTTTTATGGGCATGGAGTCAGGCATC
TTCCTCTGCATGGCTATCGATAGATATGTAGCCATTTCCTACCCCCTTCGGTACCCCTCC
ATACTCACTGAGGCTTTTGTGATCAAAGTCACACTGTTCATGGTGCTCAGGAATGGCCTG
TTGACCCTCCCAGTGCCTGTATTGGCTGCCCAGAGACACTACTGCTCCAGGAACGAAATT
GACCACTGTCTATGCTCTAATTTGGGGGTCACTAGTCTGGCCTGTGATGACATCACTATT
AACAGATTTTACCAGTTGGCCTTGGTATGGGTTATGGTTGGGGGTGACATGGGTCTGGTC
TTTGCTTCCTATGCTTTGATTATTCGCTCAGTGCTGAGGCTGAACTCTGCTAAAGCAACA
TCAAAGGCCCTGAGTACCTGCAGCTCCCATCTCATCCTCATTCTCTTTTTCTACACGGCT
GTTATTGTGGTGTCTGTCACCCAGCTGGCAGGAAGAAAGGTCCCCCTTATCCCTGCTCTC
TTCAATGTGCTGCACAGTATCATGCCCCCAGCCTTTAACCCCATGGTTTATGCCCTCCGG
ACCCAGGAGCTGAGAGTGGGCTTCCAGAGGGTGCTTGGTTTGGGTGACAATGTGTCCAGG
AAG


Conceptual translation

MDITLSITNSSRFQVPEFILLGLPGIHEWQHWLSLPLALLYILALCANILILITIQHEPS
LHQPMYWFLGVLAIVDIGLATTIIPKILAILWFDAKAISLPECFAQIYAIHSFMGMESGI
FLCMAIDRYVAISYPLRYPSILTEAFVIKVTLFMVLRNGLLTLPVPVLAAQRHYCSRNEI
DHCLCSNLGVTSLACDDITINRFYQLALVWVMVGGDMGLVFASYALIIRSVLRLNSAKAT
SKALSTCSSHLILILFFYTAVIVVSVTQLAGRKVPLIPALFNVLHSIMPPAFNPMVYALR
TQELRVGFQRVLGLGDNVSRK