Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5A2 Olfactory Receptor

Gene Symbol OR5A2
Organism Dog
Family 5
Subfamily A
Pseudo No
Location chr18:37313831-37314877 (+)
Aliases cOR5A2, cOR5A2

Sequence information


Nucleotide sequence

ATGATTTTCCAGGAAATATCCACTCATAATAACAAGCACAATCTAACTGATCACAGGATT
GTTTCTTTCCTTAATGCAGGAAGTAGGTCTATGGTTGCAGGAAAGAACAACACAATTGTG
ACGAAATTCATCCTCCTGGGATTTTCAGATCATCCTCAAATGAAGCTTTTCCTTTTCATG
TTATTTCTGGGGATTTATCTCTTGACACTAGCCTGGAACCTGAGTCTCATTGTCCTCATC
AGGATGGACTGCCACCTGCACACGCCCATGTACTTCTTCCTCAGTAACCTATCCTTCCTA
GATATCTGCTATGTGTCCTCCACAACTCCCAAGATGCTCTCTGACATCATCACAGGGCAG
AAAACCATTTCCTTTGTTGGCTGTGCCACTCAGTACTTTGTGTTCTGTGGAATGGGGCTG
ACTGAATGCTTTCTTTTGGCAGCCATGGCATATGACCGCTATGCTGCAATCTGCAACCCA
TTGCTCTACACAGCCCTCATTTCCCACACCCTTTGTTTAAAGATGGTGGTTGGTGCCTAT
GCAGGTGGATTCCTCAGTTCTTTGATTGAAACATACTCTGTCTACAAGCATGATTTCTGT
GGGCCCAACATGATTGACCACTTCTTCTGTGACCTTCCTCCCGTTCTGGTTCTATCATGC
TCTGATACCTTTACCAGCCAGGTGGTGAACTTCATTGTGGGTGTTGTTGTTGGAATGGTG
TCTGTCCTTGTGATCCTCATCTCTTATGGTTATATTGTTGCTGCTGTCCTAAAGACCAGC
TCAGCTAAAGGTAGGACCAAAGCCTTCAGCACCTGTGCCTCTCACCTGACTTCTGTGACT
CTTTTCTATGGTTCTGGTCTCTTTATGTACATGCGACCTAGTTCTAGCTACTCCCTAAAC
CGGGACAAGGTGGTGTCCATATTCTATGCTCTGGTGATCCCTATGGTGAATCCTATCATC
TACAGTTTTAGGAATAAGGAGATTAAAAATGCCATGAAGAAAGCTATGCAGAAGGATCAC
GTGCTTTCTCACGGGCCTTTGTTTTTC


Conceptual translation

MIFQEISTHNNKHNLTDHRIVSFLNAGSRSMVAGKNNTIVTKFILLGFSDHPQMKLFLFM
LFLGIYLLTLAWNLSLIVLIRMDCHLHTPMYFFLSNLSFLDICYVSSTTPKMLSDIITGQ
KTISFVGCATQYFVFCGMGLTECFLLAAMAYDRYAAICNPLLYTALISHTLCLKMVVGAY
AGGFLSSLIETYSVYKHDFCGPNMIDHFFCDLPPVLVLSCSDTFTSQVVNFIVGVVVGMV
SVLVILISYGYIVAAVLKTSSAKGRTKAFSTCASHLTSVTLFYGSGLFMYMRPSSSYSLN
RDKVVSIFYALVIPMVNPIIYSFRNKEIKNAMKKAMQKDHVLSHGPLFF