Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5A3 Olfactory Receptor

Gene Symbol OR5A3
Organism Dog
Family 5
Subfamily A
Pseudo No
Location chr18:37513461-37514507 (+)
Aliases cOR5A3, cOR5A3

Sequence information


Nucleotide sequence

ATGGCAGAACAAAGCGGTTTCTTCACCTGGATTTTCACTCCCCAGGAATCTCCCTCTGGG
GCTCTGCAGGCAGCAGAGAGAAGACACATGGCCGTGCGAAGGAACATCAGCATGACAGCC
AATTTCATCCTTGTGGGATTTTCAGAGCATCCAGAGCTACAAGTTGTCCTCTTTGTGTTG
TTTCTGGGGATCTACTCCATGACTCTGGCTTGGAACCTGGGCCTCATTGTCTTGATCAGG
ATGGAATCATGTCTCCATTCCCCCATGTATTTCTTCCTTGGAAATTTGTCTTTTGTTGAT
ATCTCATATACATCCTCCATTGCCCCCAAGATGCTCTGTGACTTCTTCAAGCAGCAGAAG
ACCATCTCCTTTGTGGGCTGTGCTGCTCAATTTTTCTTCTTCATTGGGATGGGAGGCACT
GAATGCTGTCTTCTGGCAGCCATGGCATATGACCGATATGCGGCTATCTCCAACCCTCTG
CTCTACACAGCCCTCATGTCGCCCACCATCTGTGTGAGGATGGTCATTACAGCATACACT
GGAGGGTTCCTCACTGGATTGGTCCAAACCAGCTCTGTATTCCAGCTGCATTTCTGTGGG
CCACGAGTCATTGATCACTTTTTCTGTGACCTGCCACCTCTGCTGGTCTTATCTTGCTCT
AGTACCTTCCTCAGCCAGGTAGTGAACTTTCTTGTTGTGTGTGCAGTTGGTGGGACATCA
GCTCTTGTTGTCCTGGTGTCCTATGGCTACATCATTGCTGCTGTCATGAAGATCCATTCA
ACCCAAGGGCGGATGAAGGCTTTCAACACCTGTGCCTCTCATCTGACCATGGTGATTCTC
TTCTATGGCTCTGGTCTCTTCTCATACCTTCATTCTAGTGCTAGCTACTCACAGGACCAA
GACAAGGTGGTGTCCATGTTCTATGGAGCTGTGATTCCCATGCTGAATCCTATCATATAT
AGTTTGCGAAACAAGGACATCAAAGATGCATTGAAAAAACTCAAGGACAGGAAGAAGCAG
ATATCCTCTCTGTGTCTTATAGTTCCT


Conceptual translation

MAEQSGFFTWIFTPQESPSGALQAAERRHMAVRRNISMTANFILVGFSEHPELQVVLFVL
FLGIYSMTLAWNLGLIVLIRMESCLHSPMYFFLGNLSFVDISYTSSIAPKMLCDFFKQQK
TISFVGCAAQFFFFIGMGGTECCLLAAMAYDRYAAISNPLLYTALMSPTICVRMVITAYT
GGFLTGLVQTSSVFQLHFCGPRVIDHFFCDLPPLLVLSCSSTFLSQVVNFLVVCAVGGTS
ALVVLVSYGYIIAAVMKIHSTQGRMKAFNTCASHLTMVILFYGSGLFSYLHSSASYSQDQ
DKVVSMFYGAVIPMLNPIIYSLRNKDIKDALKKLKDRKKQISSLCLIVP