Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AK6 Olfactory Receptor

Gene Symbol OR5AK6
Organism Dog
Family 5
Subfamily AK
Pseudo No
Location chr18:39017524-39018450 (-)
Aliases cOR5AK6P, cOR5AK6P

Sequence information


Nucleotide sequence

ATGGAACAAAACAATGGCACTAAAGTAACTGAATTCATCCTCCTGGGATTTGCTGGTCAA
CACAAGTCTTGGCATATCCTCTTCATAGTGTTTCTAGTGATCTATGTGGCCACCCTAATG
GGGAATATTGGGATGATCCTACTCATCAAGATTGATTCTCGCCTTCACACCCCAATGTAC
TTTTTCCTACAACACCTGGCATTTGTGGATCTCTGCTACACCTCTGCTATCACTCCCAAG
ATGCTGCAAAACCTTGTAGAAACAGAGCAATCCATCTCATTCATAGGATGTATGGTGCAA
TTACTAGTCTATGGAGCTTTTGCAACAACCGACTGCTACATCCTGGCTGCAATGGCAGTG
GACAGGTATGTGGCCATCTGCAACCCACTCCGCTATCCGACAGTCATGTCCCAGGCAGTC
TGCATTCAACTCCTGATTGGCTCATACTTCGTAGGCTTCTTGAATGCCTCTGTAAACACA
AGTTTTGCTTTTTCATTGAACTTTTGCAAATCCAATAAAATTAACCACTTTTTCTGTGAT
GAACCCCCACTCCTTGCCCTCTCGTGCTCCAACATTGACTTCAACATCATGCTACTAACT
GTCTTTGTGGGGTTTAACTTGATGTTCACTGTGCTGGTTGTCATCTTTTCCTACATATAT
ATTCTGGCTGCCATCCTGAAGATATCTTCTGCTGCAGGGAGGAAGAAAGCCTTCTCCACA
TGCGCCTCCCACTTGACAGCAGTCATAATTTTCTATGGGACTCTCTCTTACATGTACCTG
CATCATGGGACCAAGGAGTCTCAAGAGCAAGAAAAAATGGCTTCTGTGTTTTATGGCATT
ATGATCCCCATGTTAAACCCCCTCATCTACAGCCTGAGAAACCAAGATGTGAAGGAAGCC
CTAAAAGGGATTCCAAAGAAGGCCTTC


Conceptual translation

MEQNNGTKVTEFILLGFAGQHKSWHILFIVFLVIYVATLMGNIGMILLIKIDSRLHTPMY
FFLQHLAFVDLCYTSAITPKMLQNLVETEQSISFIGCMVQLLVYGAFATTDCYILAAMAV
DRYVAICNPLRYPTVMSQAVCIQLLIGSYFVGFLNASVNTSFAFSLNFCKSNKINHFFCD
EPPLLALSCSNIDFNIMLLTVFVGFNLMFTVLVVIFSYIYILAAILKISSAAGRKKAFST
CASHLTAVIIFYGTLSYMYLHHGTKESQEQEKMASVFYGIMIPMLNPLIYSLRNQDVKEA
LKGIPKKAF