Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AK7 Olfactory Receptor

Gene Symbol OR5AK7
Organism Dog
Family 5
Subfamily AK
Pseudo No
Location chr18:39037859-39038785 (-)
Aliases cOR5AK7, cOR5AK7

Sequence information


Nucleotide sequence

ATGACAAGAGAAAATAGCACTGAAGTGACTGAATTTTTTCTTCTGGGATTTGGTGCCCAA
CACAAGTATCGATACTTCCTCTTCATTGTATTTCTGGTGATCTATGCGACTTCCATGATG
GGTAACATTGGAATTATCCTACTCATCAAGACAGATTCCAGACTTCAAACACCTATGTAC
TTTTTCCTGCAACATTTGGCCTTTGTTGATATTTGTTATACCTCTGCTATCACTCCCAAG
ATGCTGCAAAACTTCATATTAGAAAATAAGTCTATATCATTTGAGGGCTGTGCAATGCAA
TTATTGGTTTATGCAACATTTGCAACCAGTGACTGCTACCTCCTGGCTGCTATGGCAGTG
GACCGTTATGTAGCCATCTGTAACCCACTTCACTATCCCATGATCATGTCCCAAAGAGTC
TGCATCCAACTGGTAGCTGGTTCATACATCATGGGTTCAATAAATGCTTCTGTGCACACA
GGTTTTACATTTTCACTGTACTTTTGCAAATCTAACACCATCAATCACTTTTTCTGTGAT
GTTCCCCCAATTCTGGCCCTTTCATGCTCCAGCATTGACATCAACATCATGCTCCTTGTT
GTCTTTGTGGGATTTAACTTGATGTTCACTGTGTTAGTTGTCATCTCTTCCTATATATAT
ATCATGGCTGCCATCCTGAAGATATCTTCTGCTACCGAGAGGAAAAAAGCCTTCTCCACG
TGCTCTTCCCACCTGACAGCCATCATCATTTTCTATACAACCCTATCATACATGTACTTA
CAGCCTCAGGCTAATAATTCTCAGGAGAATATGAAAGTGACTTCTGTATTTTACGGCATT
GTGATTCCTTTTTTGAACCCCTTGATCTATAGTTTGAGAAATAAGGAGGTAAAAGAGGCT
CTAAAAGTGATGAGGAAGAAGTTCTTC


Conceptual translation

MTRENSTEVTEFFLLGFGAQHKYRYFLFIVFLVIYATSMMGNIGIILLIKTDSRLQTPMY
FFLQHLAFVDICYTSAITPKMLQNFILENKSISFEGCAMQLLVYATFATSDCYLLAAMAV
DRYVAICNPLHYPMIMSQRVCIQLVAGSYIMGSINASVHTGFTFSLYFCKSNTINHFFCD
VPPILALSCSSIDINIMLLVVFVGFNLMFTVLVVISSYIYIMAAILKISSATERKKAFST
CSSHLTAIIIFYTTLSYMYLQPQANNSQENMKVTSVFYGIVIPFLNPLIYSLRNKEVKEA
LKVMRKKFF