Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AK8 Olfactory Receptor

Gene Symbol OR5AK8
Organism Dog
Family 5
Subfamily AK
Pseudo No
Location chr18:39,025,500-39,026,500 (-)
Aliases cOR5AK8

Sequence information


Nucleotide sequence

ATGGAACAAAACAATGGCACTAAAGTAACTGAATTCATCCTCCTGGGATTTGCTGGTCAA
CACAAGTCTTGGCATATCCTCTTCATAGCATTTCTAGTGATCTATGTGGCCACCCTAATG
GGGAATATTGGGATGATCCTACTCATCAAGATTGATTCTCGCCTTCACACCCCAATGTAC
TTTTTTCTCCAACACCTGGCATTTGTGGATCTCTGCTACACCTCTGCTATCACTCCCAAG
ATGCTGCAAAACCTTGTAGAAACAGAGCAATCCATCTCATTCATAGGATGTATGGTGCAA
TTACTAGTCTATGGAGCTTTTGCAACAACCGACTGCTACATCCTGGCTGCAATGGCAGTG
GACAGGTATGTGGCCATCTGCAACCCACTCCGCTATCCGACAGTCATGTCCCAGGCAGTC
TGCATTCAACTCCTGATTGGCTCATACTTCGTAGGCTTCTTGAATGCCTCTGTAAACACA
AGTTTTGCTTTTTCATTGAACTTTTGCAAATCCAATAAAATTAACCACTTTTTCTGTGAT
GAACCCCCACTCCTTGCCCTCTCGTGCTCCAACATTGACTTCAACATCATGCTACTAACT
GTCTTTGTGGGGTTTAACTTGATGTTCACTGTGCTGGTTGTCATCTTTTCCTACATATAT
ATTCTGGCTGCCATCCTGAAGATATCTTCTGCTGCAGGGAGGAAGAAAGCCTTCTCCACA
TGCGCCTCCCACCTGACAGCCATCACTGTGTTCTATGGGACTCTCTCTTACATGTACCTG
CATCATGGGACCAAGGAGTCTCAAGAGCAAGAAAAAATGGCTTCTGTGTTTTATGGCATT
ATGATCCCCATGTTAAACCCCCTCATCTACAGCCTGAGAAACCAAGATGTGAAGGAAGCC
CTAAAAGGGATTCGAAAGAAGGCTTTC


Conceptual translation

MEQNNGTKVTEFILLGFAGQHKSWHILFIAFLVIYVATLMGNIGMILLIKIDSRLHTPMY
FFLQHLAFVDLCYTSAITPKMLQNLVETEQSISFIGCMVQLLVYGAFATTDCYILAAMAV
DRYVAICNPLRYPTVMSQAVCIQLLIGSYFVGFLNASVNTSFAFSLNFCKSNKINHFFCD
EPPLLALSCSNIDFNIMLLTVFVGFNLMFTVLVVIFSYIYILAAILKISSAAGRKKAFST
CASHLTAITVFYGTLSYMYLHHGTKESQEQEKMASVFYGIMIPMLNPLIYSLRNQDVKEA
LKGIRKKAF