Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AL1 Olfactory Receptor

Gene Symbol OR5AL1
Organism Dog
Family 5
Subfamily AL
Pseudo No
Location chr18:39,505,600-39,506,600 (-)
Aliases cOR5AL1

Sequence information


Nucleotide sequence

ATGCCCTGGAGGATTAAAAAAAAAAAACAAAACTTTAAAATCTATTCCATGGCCAGAGGC
AATCATTCAGTAGTATCTGAGTTTATCCTCTTGGGGCTCACTGATAATCCAGAGCTTCAA
GCCATTCTCTTTGGTATATTCCTAGTCATCTATTTAGCTAGTGTCATGGGTAATCTCGGT
ATGATTGTGCTCATCCAAGTCAGCCCTCAGCTTCACACACCCATGTACTTTTTTCTCAAC
CACCTGGCTTTTGTTGATTTTTGTTTTACTTCATCTGTCACCCCAAACACCTTGGTGAAT
TTTCTGTGTGATGTGAAAAGTATAACATTTTATGCATGTGCTCTTCAGGTGTGCTGCTTC
ATCACATTTGTAGTTTGTGAACTGTATTTGCTTGCAGTCATGGCCTATGATCGGTATGTG
GCCATCTGCAACCCTCTACTGTACATCATTCTCATGCCTAGAAAGCTCTGTAATCAAATG
ATTGCTAGCACATATGCTTATGGATTCACAGTGGGTCTCATACAGACAGTGGCAACATTC
CACTTGTCTTTTTGTGGCTCCAACGTGATCAATCACTTTTATTGTGATGATGTTCCCTTG
GTTGCTCTGGCCTGCTCTGACACTCACCTCAAAGAGCTGATGTTGTTCATCATTGCTGGA
TTCAATACCCTCTGCTCTCTACTACTTGTAATAATTTCTTATATCTTCATCTTCTTTACC
ATCCTAAGGATCCATTCTACTGAAGGAAGACAGAAAGCCTTTTATACGTGTGCTTCCCAC
CTAACCTCCATCACAATATTTTATGGGACAATCATTTTTATGTATCTACTGCCCAAGTCA
AGCCATTCTCTGAACAGAGATAAATTTGCTTCAGTGTTTTATGTGGTAGTGATTCCCATG
TTAAACCCACTGATCTACAGCTTGAGAAATCAGGAGGTAAAAAATGCACTGAAAAGAATT
ATAGCAAAGTTGTGTTTGGCTGTCAAA


Conceptual translation

MPWRIKKKKQNFKIYSMARGNHSVVSEFILLGLTDNPELQAILFGIFLVIYLASVMGNLG
MIVLIQVSPQLHTPMYFFLNHLAFVDFCFTSSVTPNTLVNFLCDVKSITFYACALQVCCF
ITFVVCELYLLAVMAYDRYVAICNPLLYIILMPRKLCNQMIASTYAYGFTVGLIQTVATF
HLSFCGSNVINHFYCDDVPLVALACSDTHLKELMLFIIAGFNTLCSLLLVIISYIFIFFT
ILRIHSTEGRQKAFYTCASHLTSITIFYGTIIFMYLLPKSSHSLNRDKFASVFYVVVIPM
LNPLIYSLRNQEVKNALKRIIAKLCLAVK