Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AL2 Olfactory Receptor

Gene Symbol OR5AL2
Organism Dog
Family 5
Subfamily AL
Pseudo No
Location chr18:39,515,800-39,516,800 (-)
Aliases cOR5AL3

Sequence information


Nucleotide sequence

ATGGCAAAAGGCAATCACTCAGCAGTCACTGAGTTTATTCTCTTGGGCCTCACAGATAAT
CCGGAGATTCAGGCCGTTCTTTTCTGTGTATTCCTATTGATATACTTAGTTACTGTCTTG
GGTAATCTTGGTTTGATTGTGCTCATCCAAATCAGTCCTCAACTTCACACCCCCATGTAT
TTTTTCCTCTGTCATCTGGCTTTTGTTGATTTTTATGGTACCTCTGCCATCACTCCAAAC
ACACTGGTGAACTCTCTACGTGAAATTAAAAGTATGCCATTTTATGCATGTGCCACTCAA
GTATGTTGCTTTATCACATTTTCAGTTTGGGAATTACTAATGCTCTCTGTCATGGCCTAT
GACCGGTATGTGGCCATCTGTAGCCCTCTACTCTACATCATTCTCATGTCCAAGAAACTC
TGCATCCAGTTGGTCACTAGTTCTTATATTTATGGATTCACTGTGGGGCTCATACAAACA
ATGGTTACATTCCACATGTCTTTCTGTGATTCCAATGTGGTCAACCAGTTCTACTGTGAT
GATGTTCCCTTGATTGCTCTGGCCTGCTCTGACACTCAAGTCAAAGAATTGATGTTGCTC
ATCATTGCTGGGTTCAATGTCTTCTGCTCTCTTATCATTGTTCTTATATCCTATGGGTTC
ATTGTCTTTGCCATCTTAAAGATCCATTCTGCTGCAGGAAGACAAAAAGCCTTTTCCACC
TGTGCTTCTCACCTGTTTTCTATTACTATGTATTATGGGACCCTCAGTTTTATGTACCTG
CGCCCCAAGTCAAGCCACTCACTGGATAAAGACAAATTTGCCTCAGTATTCTATGCAGTG
GTGATTCCCATGCTAAACCCGTTAATTTACAGCTTGAGGAATCAGGAGGTAAAAAATGCC
TTCAAGAAAATATTTGAAAAGGTATATTCTAGTAATCAA


Conceptual translation

MAKGNHSAVTEFILLGLTDNPEIQAVLFCVFLLIYLVTVLGNLGLIVLIQISPQLHTPMY
FFLCHLAFVDFYGTSAITPNTLVNSLREIKSMPFYACATQVCCFITFSVWELLMLSVMAY
DRYVAICSPLLYIILMSKKLCIQLVTSSYIYGFTVGLIQTMVTFHMSFCDSNVVNQFYCD
DVPLIALACSDTQVKELMLLIIAGFNVFCSLIIVLISYGFIVFAILKIHSAAGRQKAFST
CASHLFSITMYYGTLSFMYLRPKSSHSLDKDKFASVFYAVVIPMLNPLIYSLRNQEVKNA
FKKIFEKVYSSNQ