Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AN2 Olfactory Receptor

Gene Symbol OR5AN2
Organism Dog
Family 5
Subfamily AN
Pseudo No
Location chr18:37474234-37475205 (+)
Aliases cOR5AN2, cOR5AN2

Sequence information


Nucleotide sequence

ATGGCTGGGGGAAGGAACAGTACAGCAGTTATGAAGTTCATTCTCTTGGGATTCTCTGAA
TTTCCCAAACTCACCATTGTCCTTTTTACAATATTCCTAGGGATCTACCTCATGACAGTG
TCCTGGAACCTGGGTCTCATCACTCTCATCAGGGTGGATTCCCATCTGCACATACCTATG
TACTTTTTCCTCAGTAACTTGTCCTTCCTGGACATCTGCTATGTTTCCACTATAGCGCCC
AAAATGCTCTCTGATTTCTTCAAGAAGGAGAAATCCATCTCCTTTCTGGGATGTACCACA
CAGTACTTCTTCTTCTCTAGCCTGGGTCTGACTGAGTGCTGTCTCCTGGCAGCTATGGGT
TATGACCGATACGCTGCCATTTGTAATCCTCTGCTCTATACTGCCATCATGTCACCCACC
CTCTGTGTGCAGATGGTGGCAGGATCTTGTACAACTGGATTCTTGGGCTCATTTATCCAA
CTGTGTGCCTTACTTCAGCTCCATTTCTGTGGGCCAAATGTCATCAATCATTTCTTCTGT
GATCTTCCCCAACTGCTGATCCTGTCCTGCTCTGACACATTTTTCTTTCAAATCATGACC
TCTGTGCTCACGGTGATCTTTGGACTCACATCTGTCTTGGTTATCATGATATCCTATGGT
TATATTGTTGCCACCATTCTGAAGATCACATCAGCTGAAGGCAGGTCCAAGGCCTTCAAC
ACCTGTGCTTCTCACCTGACAGCAGTGACTCTCTTCTTTGGCTCAGGTATCTTTGTTTAT
ATGTATCCAAACTCTGATGATTCCCTGAGCCAAAACAAGTTGGCATCAGTTTTATATACT
ATTATAATCCCCATGCTAAATCCATTGATCTATAGCTTGAGGAACAAGGAAATCAAAGAT
GCCCTAAACAGATGGAAGAAGAGAATTTTTTCTGTTGTTACTAATTATGGAATTTATTTC
AGATGTACAGCA


Conceptual translation

MAGGRNSTAVMKFILLGFSEFPKLTIVLFTIFLGIYLMTVSWNLGLITLIRVDSHLHIPM
YFFLSNLSFLDICYVSTIAPKMLSDFFKKEKSISFLGCTTQYFFFSSLGLTECCLLAAMG
YDRYAAICNPLLYTAIMSPTLCVQMVAGSCTTGFLGSFIQLCALLQLHFCGPNVINHFFC
DLPQLLILSCSDTFFFQIMTSVLTVIFGLTSVLVIMISYGYIVATILKITSAEGRSKAFN
TCASHLTAVTLFFGSGIFVYMYPNSDDSLSQNKLASVLYTIIIPMLNPLIYSLRNKEIKD
ALNRWKKRIFSVVTNYGIYFRCTA