Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AN6 Olfactory Receptor

Gene Symbol OR5AN6
Organism Dog
Family 5
Subfamily AN
Pseudo No
Location chr18:37496829-37497782 (+)
Aliases cOR5AN6, cOR5AN6

Sequence information


Nucleotide sequence

ATGGCTGGAGGAAGGAACAATACAATAGTCATCAGATTCATCCTTTTGGGATTCTCAGAT
TATCCCAAGCTTAAGATTCTTCTCTTTGCAGGATTCTTGGGTTCTTATGTCTTGACAGTG
GCCTGGAACCTGGGGCTCATCATCTTGATTAAGATAGACCCTTATCTACATACACCCATG
TACTTCTTCCTCAGCAACTTATCCTTCTTAGATTTTTGCTATGTTACCTCCACAACCCCG
AAAATGCTCTCAGACTTCTTCCAGAAGCCTAAATCCATCTCTTTTCTGGGATGCACTATG
CAGTACTTCTTCTTCTCTAGCCTGGGTCTGACTGAGTGCTGTCTCCTGGCAGCCATGGCT
TATGATCGATATGCTGCTATTTGTAATCCTCTGCTCTACACTACTACCATGTCACCCCCA
TTCTGTGTACAGATGATGGTTGGAGCCTATATAACTGGTCTCTTTGGTTCATTGATCCAA
CTGTGTGCTTTACTTCAGCTCAATTTCTGTGGGCCAAATGTTATCAACCATTTCTTCTGT
GACCTGCCTCAATTATTAGTCCTATCCTGCTCTGAAACCTTCTTCCTAAAAGTCATGAAG
TTTGTGATAGCAGTGATTTTTGGTGTGATATCTGTCTTTGTCATCATGATATCTTATGGT
TATATTGTTGCAACCATTCTGAAGATAAGCTCTGTTGAAGGCAGGTCCAAGGCTTTCAAC
ACCTGTACTTCTCACTTGACAGCAGTGATCTGTTTTTTTGGATCAGGACTCTTTGTCTAT
ATGCACCCCAGCACTGGCAATTCTGTGGGCCAGGACAAGATAGCATCAGTCTTCTATACA
GTGGTGATCCCGATGTTGAATCCTCTAATTTACAGTCTGAGGAACAAGGAAATCAAAGAT
GCCCTTAAGAGGTGTAAGAAGAGAGTCATTTTCCCATTGTTACAGCTAAAGGTC


Conceptual translation

MAGGRNNTIVIRFILLGFSDYPKLKILLFAGFLGSYVLTVAWNLGLIILIKIDPYLHTPM
YFFLSNLSFLDFCYVTSTTPKMLSDFFQKPKSISFLGCTMQYFFFSSLGLTECCLLAAMA
YDRYAAICNPLLYTTTMSPPFCVQMMVGAYITGLFGSLIQLCALLQLNFCGPNVINHFFC
DLPQLLVLSCSETFFLKVMKFVIAVIFGVISVFVIMISYGYIVATILKISSVEGRSKAFN
TCTSHLTAVICFFGSGLFVYMHPSTGNSVGQDKIASVFYTVVIPMLNPLIYSLRNKEIKD
ALKRCKKRVIFPLLQLKV