Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AP2 Olfactory Receptor

Gene Symbol OR5AP2
Organism Dog
Family 5
Subfamily AP
Pseudo No
Location chr18:39,349,900-39,350,800 (+)
Aliases cOR5AP3

Sequence information


Nucleotide sequence

ATGATCAGATACATGAAAGAAGTCCAAGGCAGAAATCAAACAGAAATGACTGAATTTATC
CTCTTAGGACTCTCAGACAACTCAGATCTACAAATTGTCCTCTTTGGATTGTTTCTGTTT
ATTTATATGGCAACCATGGTGGGTAATTTGGGGATGATTGTGTTAATTAAGATTGACCCC
TGTCTCCACACCCCCATGTACTTCTTTCTCAGTAGCCTGTCTTTTGTTGATGCATCTTAC
TCTTCTTCTGTCACTCCTAAGATGCTGGTAAACCTCATGGCCAAGAATAAAGCCATTTCT
TTTAATGGATGTGCTGCTCCGTTCTACTTCTTTGGTTCCTTCTTGGGGACTGAATGCTTT
CTGTTGGCCACGATGGCATATGACCGCTATGCAGCCATTTGGAACCCTCTGCGATACTCA
GTTCTCATGTCTGGGAAAATTTGCTTCTTACTAATAGCTACCTCTTTCTTAGCAGGCTTT
GGGAATGCAGCCATACACACAGGAATGACTTTCAGATTGTCCTTTTGTGGCTCTAATAGG
ATCAACCATTTCTACTGTGACACCCCACCCCTGCTCAAACTCTCTTGCTCTGACACTCGC
ATCAATGGCATTGTGATCATGGCTTTCTCCAGCTTTAATGTCATCAGTTGTGTTATGATT
GTTCTCATTTCCTACCTGTGTATCCTCATTGCCATCTTGAGAATGCCTTCTTTAGAAAGC
AGACACAAAGCCTTCTCCACCTGTGCCTCCCACCTCATGGCTGTCACCATATTCTTTGGG
ACAATTCTCTTCATGTATTTGCGCCCTACATCTAGCTATTCAATGGAACAGGACAAGATT
GTCTCTGTCTTTTATACAGTAGTGATCCCTATGCTAAATCCCCTCATCTACAGTTTGAAA
AATAAGGATGTGAAAGGGGCCTTAAAGAAGATTTTACAGAAACACCTACTG


Conceptual translation

MIRYMKEVQGRNQTEMTEFILLGLSDNSDLQIVLFGLFLFIYMATMVGNLGMIVLIKIDP
CLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAKNKAISFNGCAAPFYFFGSFLGTECF
LLATMAYDRYAAIWNPLRYSVLMSGKICFLLIATSFLAGFGNAAIHTGMTFRLSFCGSNR
INHFYCDTPPLLKLSCSDTRINGIVIMAFSSFNVISCVMIVLISYLCILIAILRMPSLES
RHKAFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQDKIVSVFYTVVIPMLNPLIYSLK
NKDVKGALKKILQKHLL