Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AQ1 Olfactory Receptor

Gene Symbol OR5AQ1
Organism Dog
Family 5
Subfamily AQ
Pseudo No
Location chr18:39813076-39814005 (-)
Aliases cOR5AQ2, cOR5AQ2

Sequence information


Nucleotide sequence

ATGGCAGGTTGGAATCATACAGGGGTGAAGGAATTCCTTCTGGTAGGTTTAACAGAAAAC
CCTAATTTGCAGATCCCTCTTTTTTTGCTTTTCACCCTTATTTACTTCACCACTCTGGCA
GGTAACTGGGGCATGATTATGTTGATCTGGTTAAATGCCCAACTTCATACTCCTATGTAC
TTCTTCCTTAGCAACCTCTCTTTTTGTGATATCTGCTACTCTACTGTCTTTGCTCCAAAG
ATGTTGGTCAATTTCCTATCGAAACACAAGTCCAGCACATTTTCTGGTTGTGTTCTACAG
AGTTTCTTTTTTGCAGTATATGTAACCACAGAAGGCATCCTCCTATCTATGATGGCTTAT
GACCGCTATGTGGCAATAGCTAATCCTTTGTTGTATAGAGTCATAATGACCCAAAGAGTT
TGTATTCAGATGGTCCTTGCATCTTACTTGGGTGGGCTCATTAACTCACTGACACATACA
ATAGGTTTGCTCAAACTGGACTTCTGTGGTCCTAACATTGTGAATCATTATTTCTGTGAC
ATTCCCCCTCTTCTGAGACTCTCTTGCTCTGATGCCCACAACAATGAGATGCTGCTTTTA
ATATTCTCTGGGGTCATTGCAATGTTCACTTTCACTATAATTATGGTCTCTTATATGTGC
ATTATCATGGCCATCCAGAGAATCCGCTCAGCTGAGGGGAGGCGCAAAGCCTTCTCTACT
TGTGCCTCTCATCTGACTGCCGTGACATTATTCTATGGGTCTGTGACCTTTAGTTACATC
CAGCCAAGTTCCCAGTATTCCCTGGAACAGGAGAAGGTCTCTGCTGTGTTTTATACATTG
GTGATCCCCATGCTAAACCCATTGATTTATAGCCTACGAAATAAGGATGTAAAAGATGCA
GCCAAGAGGTCCATATGGTGGAAGAGAACT


Conceptual translation

MAGWNHTGVKEFLLVGLTENPNLQIPLFLLFTLIYFTTLAGNWGMIMLIWLNAQLHTPMY
FFLSNLSFCDICYSTVFAPKMLVNFLSKHKSSTFSGCVLQSFFFAVYVTTEGILLSMMAY
DRYVAIANPLLYRVIMTQRVCIQMVLASYLGGLINSLTHTIGLLKLDFCGPNIVNHYFCD
IPPLLRLSCSDAHNNEMLLLIFSGVIAMFTFTIIMVSYMCIIMAIQRIRSAEGRRKAFST
CASHLTAVTLFYGSVTFSYIQPSSQYSLEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKDA
AKRSIWWKRT