Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AS1 Olfactory Receptor

Gene Symbol OR5AS1
Organism Dog
Family 5
Subfamily AS
Pseudo No
Location chr18:39827654-39828628 (-)

Sequence information


Nucleotide sequence

ATGCCATCTATTTGGGACAAGAAAAACAAGAAAATCAAGATGTGGGAGAGCAATTATACC
ATGCCAACTGAGTTTCTTCTTGTTGGATTCACAGATTATCTACCTCTCAGAGTCACACTA
TTCTTGGTATTTCTCATAGTCTATACACTAACTATGGTAGGAAATATGAGTTTAATAATC
CTAGTTAATATCAGTTCTAGCCTTCAAACTCCTATGTATTATCTCCTCAGCAACTTGTCT
TTCTTAGACATCTGCTATTCTACAGCAATCGCACCTAAAATGCTGGTAAATTTCTTAGCA
TCCAGGAAAAGCATCTCTCCCTATGGCTGTGCGCTACAAATGTTTTTCTTTGGTTGTTTT
GCTGATGCTGAGTGTCTTATTCTGGCAGCAATGGCTTATGACCGCTATGCAGCCATCTGC
AACCCATTGCTCTATTCTGCATTTATGTCTAGGAGAGTCTGTATTTGCTCCATTGTGTTG
GCATACTTCAGCGGAAGTATGACATCTATGGTACATGTGTGCCTCACATTCAGGCTGCCA
TTTTGTGGCTCCAATATTGTTAATCATTTTTTCTGTGATATCCCACCTCTCCTGGCTTTA
TCATGTGCAGATACCTATATCAACGAGCTTTTGCTCTTTGCCTTGTGTGGCTTCATTCAG
ACCAGCACTTTTGTGGTCATATTTATCTCTTACTTCTGTATTCTCCTCACTGTTTTGAGC
ATTAAGTCCTCAGGGGGCAGAAGTAAAACATTCTCCACTTGTAGTTCCCATTTTATAGCA
GTCACATTATTCTATGGAACACTCTTGTTTACATATTTACGTCCCACCACCAGCTATTCC
CTAGACACTGACAAGGTAGTTGCAGTGTTTTATACTGTTGTCTTCCCCATGTTTAACCCA
ATAATCTACAGCTTTAGAAACAAGGATGTAAAGAATGCCCTAAAAAAGCTATTAGAAAGA
AACTGGACTTTTAAA


Conceptual translation

MPSIWDKKNKKIKMWESNYTMPTEFLLVGFTDYLPLRVTLFLVFLIVYTLTMVGNMSLII
LVNISSSLQTPMYYLLSNLSFLDICYSTAIAPKMLVNFLASRKSISPYGCALQMFFFGCF
ADAECLILAAMAYDRYAAICNPLLYSAFMSRRVCICSIVLAYFSGSMTSMVHVCLTFRLP
FCGSNIVNHFFCDIPPLLALSCADTYINELLLFALCGFIQTSTFVVIFISYFCILLTVLS
IKSSGGRSKTFSTCSSHFIAVTLFYGTLLFTYLRPTTSYSLDTDKVVAVFYTVVFPMFNP
IIYSFRNKDVKNALKKLLERNWTFK