Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5AZ2 Olfactory Receptor

Gene Symbol OR5AZ2
Organism Dog
Family 5
Subfamily AZ
Pseudo No
Location chr18:38325710-38326594 (+)
Aliases cOR12G1, cOR12G1

Sequence information


Nucleotide sequence

ATGACGCTGGGGCAGAACCACACCACAGTGACAAGATTCATCCTGCTGGGCCTCACAGAC
CAGGCCCCCGGAAGACATCTCCTCTTCGGCATCTTCCTGCTAATCTATGCTGTGACCCTG
GTGGGCAACCTGGGCATGATGGACCTGATCCGTACCAGCTCCACCCTCCACACCCCCATG
TACTTCCTCCTGAGCGTGCTCTCCTTCCTGGATATATGCAATTCCTCTGTGTTCACCCCC
AGGCTGCTGATCAGCTTCCTCACCACGGACCAGTCCATCTCGTTTGCGGGCTGTGTGGTC
CAGATGGCCTTCATGATCCTCCATGGCACAGGGGAGTGCCTGCTCTTGGCCTTCATGGCC
TATGACCGATTTGTGGCCATCTGCCACCCTCTCCTCTACCATACGATCATGTCCAAGCGC
TTGTGCATCCAGCTGGCGGTGGTCACCTATGCGGCAGGGGTGTTCATTTCAGCTCTGCAG
ACGGGGAATGCCTTCATCTTGCCCTACTGTGGTCCCAACATCATTGATCACTTCTTCTGT
GACATCCCCCCCGTGCTCCAACTGGCCTGCTCAGACACCACCGTAGCCAATATCATCCTG
CTCTTCCTTTCTGCCTTGGTTACTGTCCCCACGGTGTCAGCCATCTTAGTCTCTTATACC
TACATCCTGGTCACAATCTGTAGGATGAGGTCCCTGGAGGCCCAGCGCAAAGCTTTCTCC
ACTTGTGCCTCCCACCTCATTGCCCTCTCCCTCTTCTATGGGTCTGTGTTCTTTGTCTAT
GTCCAACCCAACCCAGAAAGTGCCTCAGCCTATAATAAGACCCTGTCTGTGTTCTACACC
ATTGTGATCCCCATGCTGAACCCCCTGGTCTACAGCCTAAGGAAA


Conceptual translation

MTLGQNHTTVTRFILLGLTDQAPGRHLLFGIFLLIYAVTLVGNLGMMDLIRTSSTLHTPM
YFLLSVLSFLDICNSSVFTPRLLISFLTTDQSISFAGCVVQMAFMILHGTGECLLLAFMA
YDRFVAICHPLLYHTIMSKRLCIQLAVVTYAAGVFISALQTGNAFILPYCGPNIIDHFFC
DIPPVLQLACSDTTVANIILLFLSALVTVPTVSAILVSYTYILVTICRMRSLEAQRKAFS
TCASHLIALSLFYGSVFFVYVQPNPESASAYNKTLSVFYTIVIPMLNPLVYSLRK