Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5B3 Olfactory Receptor

Gene Symbol OR5B3
Organism Dog
Family 5
Subfamily B
Pseudo No
Location chr18:38021824-38022759 (+)
Aliases cOR5B27, cOR5B27

Sequence information


Nucleotide sequence

ATGGGTAACAGGACAGAAGTGACACAGTTCATCCTGCTGGGACTAACCAATGACCCAGAA
CTGCAGGTTCCTCTCTTCATAATGTTCACCTTCATCTACCTCATCACTCTGGTTGGGAAT
TTGGGGATTACCGTGCTGATTCTCTTGGACTCCCGTCTCCACACTCCCATGTACTTTTTC
CTCAGTAACCTGTCTCTGGCAGACTTTGGTTACTCTACAGCTGTCACACCCACAGTCATG
GCTGGGTTACTTCTAGGAGACCAGGTCATCTCCTACAGTGCATGTGCTGCTCAGATGTTC
GTTTTTGCTGTCTTTGCCACTGTGGAAAATTATCTCTTGGCCTCAATGGCCTATGACCGC
TACGCAGCAGTGTGCAAACCCCTCCATTACACCACCACTATGACGACAGGTGTGTGTGCT
CGTCTGGCCATAGGCTGCTATATCTTTGGTTTCCTGAATGCTTCTATTTACATTGGAGAC
ACATTTAGTCTCTCTTTCTGTATGAACAATGAAGTCCATCACTTTTTCTGTGATATCCCA
GCAGTCATGGTTCTTTCTTGCTCTGATAGATATGTCAATGAGCTGATTCTTATTTATGTA
GTGAGCTTCAACATCTTTTTTGCTCTCCTGGTTATCTTAATTTCCTACATATTCATATTT
ATCACCATCCTGAATATGCACTCATCTGGTGGATATCAGAAGGCTATTGCCACCTGTGCT
TCCCACCTCACTGCAGTGTCCATCTTCTATGGGACAGTCATCTTCATGTATACACAGCCC
AGCTCCAGCCATTCCATGGACACAGACAAAATGGCATCCGTGTTCTACACTATGGTTATC
CCCATGCTGAACCCTATGGTCTACAGCATGAGGAACAAGGAGGTCAAGAATGCTTTCAAG
AAGATTGTTTTAGAGTCAAAATTGTCTTTAGGATTG


Conceptual translation

MGNRTEVTQFILLGLTNDPELQVPLFIMFTFIYLITLVGNLGITVLILLDSRLHTPMYFF
LSNLSLADFGYSTAVTPTVMAGLLLGDQVISYSACAAQMFVFAVFATVENYLLASMAYDR
YAAVCKPLHYTTTMTTGVCARLAIGCYIFGFLNASIYIGDTFSLSFCMNNEVHHFFCDIP
AVMVLSCSDRYVNELILIYVVSFNIFFALLVILISYIFIFITILNMHSSGGYQKAIATCA
SHLTAVSIFYGTVIFMYTQPSSSHSMDTDKMASVFYTMVIPMLNPMVYSMRNKEVKNAFK
KIVLESKLSLGL