Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5B35 Olfactory Receptor

Gene Symbol OR5B35
Organism Dog
Family 5
Subfamily B
Pseudo No
Location chr18:38058133-38059074 (+)
Aliases cOR5B35, cOR5B35

Sequence information


Nucleotide sequence

ATGAAGAACAACACAAAAGTGACTGAGTTCATCCTACTGGGACTAACCAATGCCCCAGAG
CTACAGATCCCCCTCTTTATCATGTTCACCCTCATTTACCTCATCACTCTGGCTGGGAAC
CTGGGCATGATGATGTTGATTCTCTTGGACTCCCATCTCCACACTCCCATGTACTTTTTT
CTCAGTAACCTCTCTCTGGTGGACTTTGGTTACTCTACAGCTGTCACTCCCAAGGTCATG
GCTGGGTTACTTAGAGGAGACCAGGTCATCTCCTACAATGCATGTGCTGCTCAGATGTTC
TTTTTTGTAGCCTTTGCCACTGTGGAAAATTATCTCTTGACCTCAATGGCCTATGACCGC
TATGTGGCTGTGTGCAAACCCCTCCATTACGCCACCACCATGACAACAGGGGTGTGTGCT
TGGCTATCCATAGGCTGCTACTTCTGTGGATTTCTAAACACCTCAATCCATACTTGGAAC
ATTTTTAGGCTCTCCTTCTGTAATTCCAATGTGATCCATCACTTTTTCTGTGATGTACCG
GCAGTCATGACTCTCTCTTGCTCTAATAGACATGTCAGTGAGCTGGTTCTTGTCTTTGTA
GCAGTCTTCAACATATTTTTTGCTCTCCTCATTATCTTGATTTCCTACTTATTCATTTTT
ATCACTATCCTGAAGATGCCCTCAGTGGAGGGATACCTGAAGGCCATATCCACCTGCGTC
TCCCACCTCACTGCAGTGTCCATCTTCTATGGGTCATTCATCTTCATGTACATACAGCCC
ACCTCCAGCTACTCTATGGACACAGACAAAATCGCATCTGTGTTCTATTCTATGATCATC
CCCATGCTGAATCCCCTGGTCTATAGCCTGAGGAACAAAGACGTCAAGAATGCTTTCAAT
AAAGTTGTTGAGAAGGTTAAACTGCCTTTAAGCTTCACCTCT


Conceptual translation

MKNNTKVTEFILLGLTNAPELQIPLFIMFTLIYLITLAGNLGMMMLILLDSHLHTPMYFF
LSNLSLVDFGYSTAVTPKVMAGLLRGDQVISYNACAAQMFFFVAFATVENYLLTSMAYDR
YVAVCKPLHYATTMTTGVCAWLSIGCYFCGFLNTSIHTWNIFRLSFCNSNVIHHFFCDVP
AVMTLSCSNRHVSELVLVFVAVFNIFFALLIILISYLFIFITILKMPSVEGYLKAISTCV
SHLTAVSIFYGSFIFMYIQPTSSYSMDTDKIASVFYSMIIPMLNPLVYSLRNKDVKNAFN
KVVEKVKLPLSFTS