Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5B3B Olfactory Receptor

Gene Symbol OR5B3B
Organism Dog
Family 5
Subfamily B
Pseudo No
Location chr18:37,955,800-37,956,700 (-)
Aliases cOR5B30P

Sequence information


Nucleotide sequence

ATGGGTAACAGGACAGAAGTGACACAGTTCATCCTGCTGGGACTAACCAATGACCCAGAA
CTGCAGGTTCCTCTCTTCATAATGTTCACCTTCATCTACCTCATCACTCTGGTTGGGAAT
TTGGGGATTACCGTGCTGATTCTCTTGGACTCCCGTCTCCACACTCCCATGTACTTTTTC
CTCAGTAACCTGTCTCTGGCAGACTTTGGTTACTCTACAGCTGTCACACCCACAGTCATG
GCTGGGTTACTTAGAGGAGACCAGGTCATCTCCTACAGTGCATGTGCTGCTCAGATGTTC
ATTTTTGCTGTCTTTGCCACTGTGGAAAATTATCTCTTGGCCTCAATGGCCTATGACCGC
TACGCAGCAGTGTGCAAACCCCTCCATTACACCACCACTATGACGACAGGTGTGTGTGCT
TGTCTGGCCATAGGCTCCTATGTCTGTGGTTTCCTGAATGCCTCTATCCACATTGGAGGC
ACATTTAGTCTCTCTTTCTGTATGAACAATGAAGTCCATCACTTTTTCTGTGATATCCCA
GCAGTCATGGTTCTTTCTTGCTCTGATAGACACGTCAGTGAGCTGGCTCTTGTTTATGCA
ACCACTTTTAACATCATTTTTGCTCTCCTGGTTATCTTTGTATCCTACATATTCATATTT
ATCACCATCCTGAAGATGCACTCTTCTTCAGTATACCTAAAGGCTATATCCACCTGTGCT
TCCCACCTCACTGCAGTGTCCATCTTCTATGGAGCAGTCATCTTCATGTACACACAGCCC
AGCTCCAGCCATTCCATGGACACAGACAAAATGGCATCCGTGTTCTACACCATGGTCATC
CCCATGCTGAACCCTGTGGTCTACAGCCTGAGAAACAAGGAGGTCAAGAATGCATTCATG
AAAATTGTTTTAGAGTCAAAGTTGTCTTTAGGATTG


Conceptual translation

MGNRTEVTQFILLGLTNDPELQVPLFIMFTFIYLITLVGNLGITVLILLDSRLHTPMYFF
LSNLSLADFGYSTAVTPTVMAGLLRGDQVISYSACAAQMFIFAVFATVENYLLASMAYDR
YAAVCKPLHYTTTMTTGVCACLAIGSYVCGFLNASIHIGGTFSLSFCMNNEVHHFFCDIP
AVMVLSCSDRHVSELALVYATTFNIIFALLVIFVSYIFIFITILKMHSSSVYLKAISTCA
SHLTAVSIFYGAVIFMYTQPSSSHSMDTDKMASVFYTMVIPMLNPVVYSLRNKEVKNAFM
KIVLESKLSLGL