Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5BA1 Olfactory Receptor

Gene Symbol OR5BA1
Organism Dog
Family 5
Subfamily BA
Pseudo No
Location chr18:38374156-38375112 (+)
Aliases cOR5BA2, cOR5BA2

Sequence information


Nucleotide sequence

ATGACACCTGGAGAACTAGCCCTTGCAAGTGGCAACCACACTCCAGTTACCCAGTTCATC
TTGTTGGGATTCTCCAGCTATCCAGAGCTCCAGCAGCTTCTATTTGTAACCTTTCTGCTC
ATTTATGCCATGACAGTGATGGGCAACCTGGGAATGATGGCACTCATCTTCACAGACTCC
CGTCTCCATAGTCCCATGTATTTCTTCCTCAGTGTCCTCTCTTTTCTTGATATTTGTTAC
TCTTCTGTGGTCACACCCAAGCTCTTGGTCAACTTCCTGGCCTCTGACAAGACCATTTCT
TTTGAGGGCTGTGTGGTCCAGCTAACCTTTTTTGTGGTGCATGTGACAGCTGAGAGCTTC
CTGCTGGCCTCCATGGCCTACGATCGCTTTGTGGCCATCTGCCAACCTCTCCATTATGGT
TCGATCATGACCAAGGAGACCTGTCTCCAGCTGGTAGCTGCTTCCTATGCATTTGGTGGC
GCCAACTCTGCTATCCAGACTGGGAACGTCTTTGCTCTGCCTTTCTGTGGGCCCAACCAG
GTAACACACTACTTCTGTGACATCCCTCCCCTTCTCCGCCTGGCTTGTGCCAACACAGCC
ACAGCAGGAGTGGTCCTCTATATCTTCTCTGCTCTGGTTACCCTTCTGCCTGCTGCAGTC
ATCCTCACCTCCTACAGCTTGGTCTTGGTGGCCATTGGGAGGATGCGCTCGGCCGCTGGA
CGGGAGAAGGCCCTCTCCACCTGTGCCTCCCACTTCCTGGCCATTGCCATTTTCTACGGC
ACTGTGGTTTTCACCTATGTCCAGCCTCATGGATCCACTAATGATACCAATGGCCAAATA
GTGTCCGTGTTCTACACCATCATAATCCCCATGCTCAACCCCTTCATCTATAGCCTCCGC
AACAAAGAGGTGAAGGACGCACTACAGAGAAAGCTCCAGGTCAGTATCTTTCCCTGC


Conceptual translation

MTPGELALASGNHTPVTQFILLGFSSYPELQQLLFVTFLLIYAMTVMGNLGMMALIFTDS
RLHSPMYFFLSVLSFLDICYSSVVTPKLLVNFLASDKTISFEGCVVQLTFFVVHVTAESF
LLASMAYDRFVAICQPLHYGSIMTKETCLQLVAASYAFGGANSAIQTGNVFALPFCGPNQ
VTHYFCDIPPLLRLACANTATAGVVLYIFSALVTLLPAAVILTSYSLVLVAIGRMRSAAG
REKALSTCASHFLAIAIFYGTVVFTYVQPHGSTNDTNGQIVSVFYTIIIPMLNPFIYSLR
NKEVKDALQRKLQVSIFPC