Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5D15 Olfactory Receptor

Gene Symbol OR5D15
Organism Dog
Family 5
Subfamily D
Pseudo No
Location chr18:40123549-40124490 (-)
Aliases cOR5D19, cOR5D19

Sequence information


Nucleotide sequence

ATGTTGTTAGCAGAAGGCAATCAGAGTGTTGGAGCCACATTCACCCTCTTGGGCTTCTCG
GAATATCCAGACTTCCAGGTTCCCTTGCTATTGGTGTTCTTGACCATCTACACAGTCACT
GTGGTAGGGAACCTGGGCATGATCATGATCATCAGGGTCAGTCCCCGACTCCACACCCCC
ATGTACTTTTTCCTCAGCCACTTGTCCTTTGTCGATTTCTGTTATTCCACCACAGTTACA
CCCAAACTGTTGGAGAATTTGGTTGTGGAAGACAGATCCATCTCCTTCGTAGGCTGCATC
ATGCAGTTCTTCTTGGCTTGTGTATGTGCGGTGGCAGAAACATTCATGTTGGCAGTGATG
GCCTATGACCGATTTGTGGCTGTTTGTAACCCTCTACTCTACACGGTTGTCATGTCCCAG
AAGCTGTGTGCGTTGTTAGTGGCGGGGCCCTACATATGGGGTATAGCCTCTTCCCTGACA
CTCACCTGTTTTCTCCTGACATTATCCTTCTGTGGGTCTAATACCATAAATAATTTTGTC
TGTGAGCACTCTGTCATTGTCTCTGTCTCCTGCTCTGACCCCTACATCAGCCAAATGCTT
TGTTTTGTCATTGCCATATTCAACGAAGTCAGCAGCCTGGTCATCATTTTCACTACTTAT
ATTTTCATTTTTGTCACAGTCATAAAAATGTCTTCTGCTGGTGGGCGCCAAAAAGCTTTC
TCCACTTGTGCCTCCCACCTGACTGCCATCACCATCTTCCATGGGACTATCCTGTTCCTT
TATTGTGTACCCAACTCCCAAAACTCATGGCTCATAGTCAAAATAGGTTCTTTATTTTAT
ACAGTGGTGATTCCTATGCTGAACCCTCTGATCTATAGCCTCCGAAATAAAGACGTGAAG
GAGAGTGTCAAGAAGTTAATAAATCACTCAATACAAGTTTGT


Conceptual translation

MLLAEGNQSVGATFTLLGFSEYPDFQVPLLLVFLTIYTVTVVGNLGMIMIIRVSPRLHTP
MYFFLSHLSFVDFCYSTTVTPKLLENLVVEDRSISFVGCIMQFFLACVCAVAETFMLAVM
AYDRFVAVCNPLLYTVVMSQKLCALLVAGPYIWGIASSLTLTCFLLTLSFCGSNTINNFV
CEHSVIVSVSCSDPYISQMLCFVIAIFNEVSSLVIIFTTYIFIFVTVIKMSSAGGRQKAF
STCASHLTAITIFHGTILFLYCVPNSQNSWLIVKIGSLFYTVVIPMLNPLIYSLRNKDVK
ESVKKLINHSIQVC