Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5D17 Olfactory Receptor

Gene Symbol OR5D17
Organism Dog
Family 5
Subfamily D
Pseudo No
Location chr18:40144915-40145862 (-)
Aliases cOR5D20, cOR5D20

Sequence information


Nucleotide sequence

ATGGAACTAGATGAAGGAAATCAGAGCTCTGTGACCACATTCATTCTCCTGGGTTTCTCA
GAATACCCACACCTCCAGATGCCCCTCTTCCTGGTGTTCTTGACTGTCTACACGGTCACT
CTGGTGGGGAATCTGGGCATAATCATGGTCATAAGGATCAATCCCAAACTCCACACCCCC
ATGTACTTTTTCCTCAGCCACCTATCCTTTTTGGATATTTGTTATTCCAGTGTCTTTACA
CCGAAACTATTAGAAACCTTGGTCACAGAAGACAGAAGTATCTCCTTCAAAGGATGCATG
GTGCAATTTTTCTTCATTTGTGCATTTGTAATTACGGAAATGTTCATGTTGGCAGTAATG
GCCTATGACCGATTTGTGGCTGTCTGTAACCCTCTGCTCTACACAGTTGCTATGTCTCAG
AAACTCTGTGCCCTCTTGGTAGCTGGAACCTACACGTGGGGTGGCATATGTTCCTTGACA
CTCACATACTCTCTTTTGGAACTATCCTACTGTGGTTCCAATATCATAAATCACTTTGGC
TGTGAGTATTCTGCCATCCTCTCTTTATCCTGTTCTGACCCCTACTTCAGTCAGATGACA
TGTTTGGTCATTTCTACATTCAACGAGGCTTGCAGCCTCCTGATTATCCTGGCCTCCTAT
ATATTCATAGTTGTCACCATCATCAAGATGCCTTCTGCTGGTGGACTCCAGAAGGCCTTC
TCCACCTGTGCCTCCCACCTGACCGCCATCACCATCTTCCATGGAATAATCCTTCTTCTC
TACTGTGTGCCCAACTCCAAAAGCTCGTGGCTCCTAGTCAAAGTGGCCACGGTGTTTTTT
ACTGTCATGATCCCCATGTTGAACCCCCTTATTTACAGCCTGAGGAACAAAGACGTGAAA
GACACAGCCAGGAAGTTAATCCATACCAAACTGCTTTCTCACTCAATG


Conceptual translation

MELDEGNQSSVTTFILLGFSEYPHLQMPLFLVFLTVYTVTLVGNLGIIMVIRINPKLHTP
MYFFLSHLSFLDICYSSVFTPKLLETLVTEDRSISFKGCMVQFFFICAFVITEMFMLAVM
AYDRFVAVCNPLLYTVAMSQKLCALLVAGTYTWGGICSLTLTYSLLELSYCGSNIINHFG
CEYSAILSLSCSDPYFSQMTCLVISTFNEACSLLIILASYIFIVVTIIKMPSAGGLQKAF
STCASHLTAITIFHGIILLLYCVPNSKSSWLLVKVATVFFTVMIPMLNPLIYSLRNKDVK
DTARKLIHTKLLSHSM