Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5D18 Olfactory Receptor

Gene Symbol OR5D18
Organism Dog
Family 5
Subfamily D
Pseudo No
Location chr18:40105458-40106396 (-)
Aliases cOR5D21, cOR5D21

Sequence information


Nucleotide sequence

ATGTTACTGTCAGAGAGAAATAAAAGTGGGGCTACATTCACTCTCTTGGGCTTCTCAGAT
TACCCAGAACTGCAAATCCCTCTCTTCTTGATTTTTCTGGCCATCTATAGTGTCACTGTT
GTAGGTAATCTTGGGATGATAGTTATAATCAAGATTAACCCCAAGCTGCACACCCCCATG
TACTTCTTCCTCAGCCACCTCTCAGTGGTGGATTTCTGCTACTCCTCCATCATTGCTCCC
AAGGCCCTGGCAAACCTGGTTGCAGAAGACAGAACCATTTCATTTCCAGGATGTGTAGTA
CAGTTCTTTTTCTTTTGTACCTTTGTGGTAGCTGAATCCTTTTTATTAGCTGTGATGGCC
TATGACCGCTTTGTGGCCATTTGCAATCCTCTGCTCTACACAGTGACAGCGTCCCAGAAG
CTCTGTGCCATGCTGGTGGTCGGATCATATGCATGGGGAGTAACATGTTCCTTGATACTC
ACATGCTCTGTGGTCAAATTATCTTTTCAGGGTTTCAACACCATCAATCATTTCTTCTGT
GAGTTCTCTGCATTGATCTCCCTGTCTTGCTCTGATACTTACATCAGTCAGTTGCTGCTT
TTCATTTTTGCCACCTTTAATGAGGTCAGCACACTGCTCATCATTCTCTTGTCTTACGTA
TTTATCGTTGTCACCATCCTCAAGATGCGTTCAGCCAGTGGTCGCCGCAAAGCCTTTTCC
ACCTGCGCCTCCCATCTGACTGCCATCACCATCTTCCATGGGACCATCCTTTTTCTCTAC
TGTGTGCCCAACTCCAAAAACTCAAGGCACACAGTCAAAGTGGCATCTGTGTTTTACACA
GTGGTGATCCCCATGTTGAATCCCCTGATCTACAGTCTGAGAAATAAGGATGTCAAGGGT
ACAGTCAATAAATTAATAGGTACTAAAGTTTTTTCTTTT


Conceptual translation

MLLSERNKSGATFTLLGFSDYPELQIPLFLIFLAIYSVTVVGNLGMIVIIKINPKLHTPM
YFFLSHLSVVDFCYSSIIAPKALANLVAEDRTISFPGCVVQFFFFCTFVVAESFLLAVMA
YDRFVAICNPLLYTVTASQKLCAMLVVGSYAWGVTCSLILTCSVVKLSFQGFNTINHFFC
EFSALISLSCSDTYISQLLLFIFATFNEVSTLLIILLSYVFIVVTILKMRSASGRRKAFS
TCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKG
TVNKLIGTKVFSF