Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5D3 Olfactory Receptor

Gene Symbol OR5D3
Organism Dog
Family 5
Subfamily D
Pseudo No
Location chr18:40154673-40155542 (-)
Aliases cOR5D23, cOR5D23

Sequence information


Nucleotide sequence

ATGCCCCTGTTCCTTTTATTCTTTACCATCTACACAGTTATTGTTTTGGGAAATCTGGGC
ATGGTCATGATTATCCAGATCAATCCCAAACTCCATACCCCCATGTACTTCTTCCTCAGC
CATCTTTCTTTTGTTGATTTCTGTTACTCTACAGTAGTTACACCCAAACTATTAGAAAAC
TTGGTTGTGGAAGACAGAACCATCTCCTTTATAGGATGCATTATGCAATTCTTCTTTGCA
TGCATATTTGTGGTGACGGAAACATTCATGTTGGCAGTGATGGCCTATGATCGATATGTG
GCAGTTTGTAACCCACTCCTCTACACAGTTGTCATGTCTCAGAAGCTTTGCTCCTTATTG
GTGAGTGCATCATACTCCTGGGGTATAGCCTGCTCCTTAACATACACATACTTTTTGTTG
ACCTTATCCTTTTGTGGGACTAACTTCATAAATAACTTTGTCTGTGAACATGCTGCCATT
GTCTCTGTGTCCTGCTCTGACCCCTACATTAGCCAGAAGATCATTTTAGTCTCTGCCACA
TTCAATGAAATAAGCAGCTTGATGATCATTCTTACCTCCTATGTTTTTATCTTTATCACT
GTCATGAAGATGCCTTCAACTGGGGGTCGCCACAAAGTCTTCTCAACATGTGCCTCTCAT
CTGACTGCTATTACAATCTTCCATGGGACCATCCTATTCCTCTACTGTGTACCTGACTCC
AGAAGTTCATGGCTCATGGTCAAGGTGGCTTCTGTGTTTTACACTGTGGTCATCCCCATG
CTGAACCCACTGATCTACAGTCTCAGGAACAAAGATGTGAAGGAGACAGTAAAGAAGTTA
ATTAATGTTAAATTGTTCTGTGACAAAATA


Conceptual translation

MPLFLLFFTIYTVIVLGNLGMVMIIQINPKLHTPMYFFLSHLSFVDFCYSTVVTPKLLEN
LVVEDRTISFIGCIMQFFFACIFVVTETFMLAVMAYDRYVAVCNPLLYTVVMSQKLCSLL
VSASYSWGIACSLTYTYFLLTLSFCGTNFINNFVCEHAAIVSVSCSDPYISQKIILVSAT
FNEISSLMIILTSYVFIFITVMKMPSTGGRHKVFSTCASHLTAITIFHGTILFLYCVPDS
RSSWLMVKVASVFYTVVIPMLNPLIYSLRNKDVKETVKKLINVKLFCDKI