Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5G1 Olfactory Receptor

Gene Symbol OR5G1
Organism Dog
Family 5
Subfamily G
Pseudo No
Location chr18:39,198,600-39,199,500 (+)
Aliases cOR5G1

Sequence information


Nucleotide sequence

ATGGCCTTTGAAAACTATACGAGGGTCACCGAATTCATTTTCACAGGTTTGAATTGCAGC
CCGCAATTGCAGGTTTTCCTCTTCCTGCTCTTCCTGAGTTTTTACTTCATCAATCTAACT
GGAAACTTGGGTATGATTATTCTGATTCGGGTTGATTCCCGCCTTCACACGCCCATGTAC
TTTTTTCTCAGCCACTTGTCCTTTGTGGATATCTGCTTCTCCTCTGTTGTGAGCCCAAAG
ATGCTCACCGACTTCTTTGTGAAGAGGAAGGCCATCTCTTTCTTGGGCTGTGCTTTGCAA
CAGTGGTTTTTTGGGTTCTTTGTGGCAGCAGAGTGTTTTCTCCTGGCGTCCATGGCCTAT
GACCGCTATGTGGCCATCTGCAACCCATTATTGTATTCAGTTGCCATGTCCCAGAGACTC
TGTGTCCAGCTGGTGGTTGGTCCCTACATCATCGGGTTTGTGAACACCATGACCCATACA
ACGAATGCATTTCGTCTTCCTTTTTGTGGCCCCAATGTTCTTAATCATTTCTTCTGTGAT
ATGTCCCCCCTGCTTTCCCTTGTATGTGCTGACAGCAGGCTTACTAAGTTGGTAGTTTTT
GTTGTGGCTGGAGCTGTGGGAGTCTTCAGTGGTTTGACTATCGTGGTCTCCTACATTTAT
ATCCTCATTGCCATCATGAAGATCCACTCTGCCGATGGGAGGCGCAAAGCCTTTTCTACA
TGCTCTTCTCACCTGACCGCTGTCTCCATCCTATACGGTACTCTTTTCTTTATTTATGTA
CGGCCTAGTGCCAGTTTCTCACTGGATCTCAACAAAGTGGTGTCGGTATTTTACACAGCA
GTGATCCCCATGTTGAACCCGCTTATCTACAGCTTGAGGAACAAGGAGGTCAAAGATGCC
ATCCATAGGACTATTACTAGGAGGAAGTTTTGTAGGGCA


Conceptual translation

MAFENYTRVTEFIFTGLNCSPQLQVFLFLLFLSFYFINLTGNLGMIILIRVDSRLHTPMY
FFLSHLSFVDICFSSVVSPKMLTDFFVKRKAISFLGCALQQWFFGFFVAAECFLLASMAY
DRYVAICNPLLYSVAMSQRLCVQLVVGPYIIGFVNTMTHTTNAFRLPFCGPNVLNHFFCD
MSPLLSLVCADSRLTKLVVFVVAGAVGVFSGLTIVVSYIYILIAIMKIHSADGRRKAFST
CSSHLTAVSILYGTLFFIYVRPSASFSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKDA
IHRTITRRKFCRA