Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5G5 Olfactory Receptor

Gene Symbol OR5G5
Organism Dog
Family 5
Subfamily G
Pseudo No
Location chr18:39168192-39169133 (+)
Aliases cOR5G8, cOR5G8

Sequence information


Nucleotide sequence

ATGGATTATGGAAATCAGACTTTGGTGACTGAATTTTTTTTTGTGGGCTTAACAAATCAA
TTGCAGCACCAGGTTGTTCTCTTTGTGATATTTCTCTTGGTTTATCTTGTTACTCTTCTG
GGAAATGTGGGGATGATCACCCTCATTTGGTTGGATCCCCGACTCCACACACCTATGTAC
TTTTTTCTTAGCCACTTGTCCTTTGTGGATGTCTGCTCTTCTTCTGCCATTGGTCCTAAG
ATGTTGACTGACATCTTTGTGGAGAAAAAAGTAATCTCTTTTTTTGGTTGTGCTGCTCAG
ATCTGTTTTTTTGGTCAGTTTGTAGTGACTGAGTGTTTTCTCCTGGCCTCCATGGCATAT
GACCGGTATATGGCCATCTGTAAGCCCTTGCTGTATACACTCATTATGTCCCAGCGTGTC
TGTGTGCAGCTAGTGGTAGGACCTTATGCCATGGGTCTGATGAGCACCATGACCCACACG
ACTTTAGCCTTTAACCTACCTTATTGTGGCCCCCAAATCATCAATCACTTCTTCTGTGAC
CTTCTTCCTGTTCTGTCCTTGGCATGTGCAGACACCCAGGTCAATCAGTTTCTACTTTTC
ATCTTGGCTGGAGCTCTAGGTGTGCTCAGTGGTGTGATCATCCTAGTTTCCTACACTTAC
ATTGTCATCACTATCCTGAGGATCCGCTCTGCTGCGGGGAGGCACAAAGCCTTTTCCACC
TGCTCTTCACACCTGACAGCTGTCTCCATCCTGTATGGGACACTCTTCTTTATCTACGTA
CGCCCCAGTTCTAGTTTCTCCCTGGACATCAATAAAGTGGTTTCAGTGTTCTATACATCT
GTGACTCCTATGTTGAACCCCCTTATCTACAGCCTGAGAAACAGAGAGGTCAAGGATTCA
TTCAGAAGGACGTTTGAGAAGAAGCAGTTTCTCATGAGTAGA


Conceptual translation

MDYGNQTLVTEFFFVGLTNQLQHQVVLFVIFLLVYLVTLLGNVGMITLIWLDPRLHTPMY
FFLSHLSFVDVCSSSAIGPKMLTDIFVEKKVISFFGCAAQICFFGQFVVTECFLLASMAY
DRYMAICKPLLYTLIMSQRVCVQLVVGPYAMGLMSTMTHTTLAFNLPYCGPQIINHFFCD
LLPVLSLACADTQVNQFLLFILAGALGVLSGVIILVSYTYIVITILRIRSAAGRHKAFST
CSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSVFYTSVTPMLNPLIYSLRNREVKDS
FRRTFEKKQFLMSR