Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5H12 Olfactory Receptor

Gene Symbol OR5H12
Organism Dog
Family 5
Subfamily H
Pseudo No
Location chr33:5202604-5203632 (+)
Aliases cOR5H12

Sequence information


Nucleotide sequence

ATGCATAATTCACTTCAAATTTTCTCTCCATATTTTCATGTTGTAAATTCAATGAGTTTT
TTCCCATTTACTGTTTCAACTCAGGTAACACCTGGTGAGGACATGGAAAAGGAAAATGCA
ACCTTGTTGACAGAGCTGATTCTCACAGGACTCACATATGAACCACAATGGCACATTCCC
CTGTTCCTGGTGTTCTTGGTTATCTATCTTCTCACCATTGTCGGGAACCTTGGTCTGATT
GCTCTCATCTGGAATGACCCTCAGCTTCACATCCCCATGTACTTGTTTCTTGGCAGTCTG
GCACTTGTGGATGCTTGGATATCATCCACAGTGACCCCCAAGATGCTGGTCAACTTCTTT
GCCAAGAGAAAAGTGATCTCTCTCTCTGAATGTATGATACAGTTTTTTTCCTTTGCAATC
AGTATAACGACGGAATGCTTTTTGCTGGCAACAATGGCTTATGATCGATATGTGGCCATA
TGCAAACCATTACTTTATCCAGTGATTATGTCTAATACACTGTGCATCCGGCTGTTAGTT
TTGTCACTTTTAGGTGGACTTCTCCATGCCATAATTCATAGTTCTTTTTTATTCAGATTA
ACCTTCTGTGATTCCATCATAGTACATCACTTTTATTGTGACATTATACCCCTGCTTAAG
ATCACCTGTACTGACCCTTCTATTAATTATCTGATAGTATTTATTTTTGCTGGGTCAATA
CAGATGTTCACCATTCTGATAGTTCTTGTCTCCTACACACTAGTGCTCTTCACAATATTA
AGAAAGAAGTCTCTACAAGGCATAAAGAAAGCCTTCTCCACCTGTGGGGCCCATCTCTTT
TCTGTCTCCTTGTACTATGGTGCTCTGGTCTTCATGTATGTGCGTCCCGTAGCTGCACAG
TCAGAAGATCAAGATATGATGGACTCTCTCTTTTACACCATCATAATTCCTTTCTTAAAC
CCAATTATCTACAGCTTGAGAAACCAGAAAGTCATAGATTCATTGAGAAAAACATTAAAG
AGAAATTCT


Conceptual translation

MHNSLQIFSPYFHVVNSMSFFPFTVSTQVTPGEDMEKENATLLTELILTGLTYEPQWHIP
LFLVFLVIYLLTIVGNLGLIALIWNDPQLHIPMYLFLGSLALVDAWISSTVTPKMLVNFF
AKRKVISLSECMIQFFSFAISITTECFLLATMAYDRYVAICKPLLYPVIMSNTLCIRLLV
LSLLGGLLHAIIHSSFLFRLTFCDSIIVHHFYCDIIPLLKITCTDPSINYLIVFIFAGSI
QMFTILIVLVSYTLVLFTILRKKSLQGIKKAFSTCGAHLFSVSLYYGALVFMYVRPVAAQ
SEDQDMMDSLFYTIIIPFLNPIIYSLRNQKVIDSLRKTLKRNS