Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5H9 Olfactory Receptor

Gene Symbol OR5H9
Organism Dog
Family 5
Subfamily H
Pseudo No
Location chr33:5212986-5213912 (+)
Aliases cOR5H9

Sequence information


Nucleotide sequence

ATGGAAAAGGAAAATGCAACCTTGTTGACAGAGCTGATTCTCACAGGACTCACATATGAA
CCACAATGGCACATTCCCCTGTTCCTGGTGTTCTTGGTTATCTATCTTCTCACCATTGTC
GGGAACCTTGGTCTGATTGCTCTCATCTGGAATGACCCTCAGCTTCACATCCCCATGTAC
TTGTTCCTTGGCAGTCTGGCATTTGTGGATGCCTGGGTATCATCCACAGTGACCCCCAAG
ATGCTGGTCAACTTCTTTGCCAAGAGCAAAATGATCTCTCTCTCTGAATGTATGATACAG
TTTTTTTCCTTTGCAATAAGTGCAACGACGGAATGCTTTTTGCTGGCAACAATGGCTTAT
GATCGCTATGTGGCCATATGCAAACCATTAACTTATCCAGTGATTATGTCCAATACACTC
TGCATCCGGCTGATACTTTTGTCATTTTTAGGAGGACTTCTTCATGCCATAATTCACAGT
TCTTTTTTATTCAGATTAACCTTCTGCGATTCCATCATAGTACATCACTTTTATTGTGAC
ATTATACCCCTGCTTAAGATCACTTGTACTGATCCTTCTATTAATTATCTGATAGTATTT
ATTTTTGCTGGGTCAATACAGATGTTCACCATTCTGATAGTTCTTGTCTCCTACACACTA
GTGCTCTTCACAATATTAAGAAAGAAGTCTCTACAAGGCATAAAGAAAGCCTTCTCCACC
TGTGGGGCCCATCTCTTATCTGTTTCCTTGTACTATAGTGCTCTGGTCTTCATGTATGTG
CGTCCCGTAGCTGCACAGTCAGAAGATCAAGATATGATAGACTCTCTCTTTTACACCATC
ATAATTCCTTTCTTAAACCCAATTATCTACAGCTTGAGAAACCAGAAAGTCATAGATTCA
TTGAGAAAAACATTAAAGAGAAATTCT


Conceptual translation

MEKENATLLTELILTGLTYEPQWHIPLFLVFLVIYLLTIVGNLGLIALIWNDPQLHIPMY
LFLGSLAFVDAWVSSTVTPKMLVNFFAKSKMISLSECMIQFFSFAISATTECFLLATMAY
DRYVAICKPLTYPVIMSNTLCIRLILLSFLGGLLHAIIHSSFLFRLTFCDSIIVHHFYCD
IIPLLKITCTDPSINYLIVFIFAGSIQMFTILIVLVSYTLVLFTILRKKSLQGIKKAFST
CGAHLLSVSLYYSALVFMYVRPVAAQSEDQDMIDSLFYTIIIPFLNPIIYSLRNQKVIDS
LRKTLKRNS