Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5I1B Olfactory Receptor

Gene Symbol OR5I1B
Organism Dog
Family 5
Subfamily I
Pseudo No
Location chr18:39999907-40000848 (+)
Aliases cOR5I2, cOR5I2

Sequence information


Nucleotide sequence

ATGGAATTGATGGATGGAAACTACACCTTGGTGACTGAGTTTATTCTTTTAGGGTTTCCG
ACCCGCCCTGAACTGCAGATTGTCCTATTCCTCATGTTTCTGACATTGTATGGTATGATT
TTAACAGGGAATATTGGACTGATGATGTTAATCAGGACAGACCCTCACCTTCAAACCCCT
ATGTATTTTTTCCTTAGCAACCTCTCCTTTGCAGATCTTTGTTACTCATCAGTCATTGTT
CCCAAAATGCTGGTCAATTTCCTCTCAGAAAATAAATCTATCTCCTATTATGGCTGTGCC
CTACAGTTTTATTTTTTCTGTGCTTTTGCTGATACAGAATCCTTTATCCTGGCTGCCATG
GCATACGATCGCTATGTTGCCATCTGTAATCCTTTACTGTATACAGTTGTGATGTCTCGG
GGCATCTGTGTATGGTTGATTGTCTTGTCCTACATTGGAGGTAACATGAGTTCCCTGGTT
CACACGTCCTTTGCCTTTATTTTGAAATACTGCGATAAAAATGTCATTAATCATTTTTTC
TGCGACCTCCCTCCCCTGCTTAAGCTATCCTGCACAGACACCTCAGTTAATGAGTGGCTT
CTCTCCACATATGGCAGCTCAGTGGAAATTATCTGCTTCATCGTCATTGTCATCTCCTAC
TATTTCATTCTGCGCTCAGTCTTGAGGATCCGCTCTTCCAGTGGCAGAAAGAAAACCTTC
TCCACGTGTGCCTCTCACCTGACTTCTGTGGCCATCTATCAGGGGACTCTTCTCTTCATT
TACTCACGGCCCAGCTATCTGTATTCTCCCAACACTGATAAAATTATCTCCGTGTTCTAC
ACCATTATTATCCCAGTGCTGAATCCATTGATTTATAGTTTGAGAAATAAAGATGTAAAA
GATGCCGCTAAGAGAGCTGTAAGGTTAAAAGTGGATTCCTCA


Conceptual translation

MELMDGNYTLVTEFILLGFPTRPELQIVLFLMFLTLYGMILTGNIGLMMLIRTDPHLQTP
MYFFLSNLSFADLCYSSVIVPKMLVNFLSENKSISYYGCALQFYFFCAFADTESFILAAM
AYDRYVAICNPLLYTVVMSRGICVWLIVLSYIGGNMSSLVHTSFAFILKYCDKNVINHFF
CDLPPLLKLSCTDTSVNEWLLSTYGSSVEIICFIVIVISYYFILRSVLRIRSSSGRKKTF
STCASHLTSVAIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDVK
DAAKRAVRLKVDSS