Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5J1 Olfactory Receptor

Gene Symbol OR5J1
Organism Dog
Family 5
Subfamily J
Pseudo No
Location chr18:39798482-39799417 (-)
Aliases cOR5J1, cOR5J1

Sequence information


Nucleotide sequence

ATGGCTGATGTTAATTTTACATTGGTTACAGAGTTTATCCTTTTGGGACTGACAGATCGT
GCTGAACTGAAAGTTGTCCTCTTTGTGCTTTTCCTGCTGATCTATACCATTTCTTTGGTG
GGGAATCTAGGAATGGTCTTTCTAATCCAAGTAACTCCCAAACTCCAAACACCCATGTAT
CATTTCCTTAGCTGCCTGTCATTTGTTGATGCCTGCTATTCATCAGTCTTTGCACCAAAA
ATGCTGCTGAACTTCTTTGTTGAACGGGAGACAATCTCATTCTCTGCATGCATTGTGCAG
TATTTTTTATTTGTGTCACTCCTTACCACTGAGGGCTTCTTGCTGGCGGCAATGGCTTAT
GACCGCTACATGGCCATTGTGAACCCTTTATTTTACACAGTGGCTATGACTAAAATAGTT
TGCATTGTCCTGGTCATTGGGTCATGTGTAGGAGGCTTAATCAACTCATTGACACACACA
ATTGGTTTGGTGAAATTGTCTTTCTGTGGGCCAAATATCATCAGTCACTTCTTCTGTGAC
CTTCCCCCACTATTGAAGTTGTCATGTTCTGACACATCCATGAATGAACTGTTGCTTTTA
ATCTTCTCTGGAATTATTGCTATGATCACTTTCTTGATTGTGATGATCTCCTATGTCTTC
ATTGTTGCTGCTATTCTGAGGATCCGCTCAGCAGCAGGTAGACACAAAGCCTTCTCCACC
TGTGCTTCACATTTAACGGCTGTGACTTTATTCTATGGCTCTATAAGCTTTAGTTACATT
CAACCAAGCTCTCAATATTCCTTAGAACAAGAAAAGGTGGTATCTGTGTTTTATACCCTG
GTGATTCCTATGTTAAACCCAGTGATTTACAGCCTGAGAAACAAGGAAGTAAAAGATGCT
GTGAAAAGAGCTACAGAAATAAAATATTGTCCTTGT


Conceptual translation

MADVNFTLVTEFILLGLTDRAELKVVLFVLFLLIYTISLVGNLGMVFLIQVTPKLQTPMY
HFLSCLSFVDACYSSVFAPKMLLNFFVERETISFSACIVQYFLFVSLLTTEGFLLAAMAY
DRYMAIVNPLFYTVAMTKIVCIVLVIGSCVGGLINSLTHTIGLVKLSFCGPNIISHFFCD
LPPLLKLSCSDTSMNELLLLIFSGIIAMITFLIVMISYVFIVAAILRIRSAAGRHKAFST
CASHLTAVTLFYGSISFSYIQPSSQYSLEQEKVVSVFYTLVIPMLNPVIYSLRNKEVKDA
VKRATEIKYCPC