Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5J2 Olfactory Receptor

Gene Symbol OR5J2
Organism Dog
Family 5
Subfamily J
Pseudo No
Location chr18:39577430-39578365 (+)
Aliases cOR5J3, cOR5J3

Sequence information


Nucleotide sequence

ATGGCCAAAGAGAATTTCACAGCTGTTACTGAATTTATTCTTTTGGGACTGACAGACCAC
CCTGACCTGAAAATCATACTTTTTGTGTTGTTCTTGGTGATTTATGCGATTACCTTGCTG
GGGAATCTGGGTATGATCTTCATAATCCAAATAACTCCCAAGCTCCACACACCCATGTAT
TTTTTCCTCAGCTGCCTTTCATTTGTGGATGCCTGCTATTCATCTGTTATTGCACCGAAA
ATGCTGATCAGCTTCTTGGTTGTGAAGGAAACCATCTCATTCTCTGCCTGCATTGTGCAA
CATTTGTTTTTTGGGGTGTTTATTACCACAGAAGGCTTCTTGTTGTCAGTGATGGCATAT
GACCGTTATGTGGCCATTGTCAACTCTTTGCTTTACAGTGCAGCCATGTCTAAGAGGAAG
TGTGTAGGGTGGGTCAATGGATCTTGGATATGTGGAATAATTAACTCATTAATACACACA
ATAAGCTTAGGCAGACTGTCCTTCTGTGGGTCCAATGTTGTTAACCACTTCTTCTGTGAT
ATTCCCTCACTCCTAAAGCTATCATGTTCTGATACTACCATGAATGAATTGTTGCTCTTA
ACTTTCTCTGGAGTCATTGCCATGGCCACCTTCTTGATTGTGATCATTTCCTACGTGTTT
ATTGCTGTTGCTATTCTGAGGATCCGCTCAGCAGCAGGCGGACAGAAAGCCTTCTCCACG
TGTGCCTCCCACCTGACTGTTGTGACCATATTCTATGGTACTTTAAGCTTTAGCTACATC
CAGCCAAGTTCCCAGTATTCTGTGGAGCAGGAGAAGGTGGTGTCTGTGTTCTATACACTA
GTGATTCCCATGTTAAACCCACTTATTTACAGTCTGAGGAACAAAGAGGTAAAGGATGCT
GTCAAAAGGGCCATCGAAATGACACATTTCCCTTGT


Conceptual translation

MAKENFTAVTEFILLGLTDHPDLKIILFVLFLVIYAITLLGNLGMIFIIQITPKLHTPMY
FFLSCLSFVDACYSSVIAPKMLISFLVVKETISFSACIVQHLFFGVFITTEGFLLSVMAY
DRYVAIVNSLLYSAAMSKRKCVGWVNGSWICGIINSLIHTISLGRLSFCGSNVVNHFFCD
IPSLLKLSCSDTTMNELLLLTFSGVIAMATFLIVIISYVFIAVAILRIRSAAGGQKAFST
CASHLTVVTIFYGTLSFSYIQPSSQYSVEQEKVVSVFYTLVIPMLNPLIYSLRNKEVKDA
VKRAIEMTHFPC