Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5J2B Olfactory Receptor

Gene Symbol OR5J2B
Organism Dog
Family 5
Subfamily J
Pseudo No
Location chr18:39586114-39587067 (+)
Aliases cOR5J4, cOR5J4

Sequence information


Nucleotide sequence

ATGAGAAGAAACAAACAAATGGCTGAAGAGAATTATACAACTGTTACTGAATTTATTCTT
TTGGGACTGACGGACCTCACTGACCTGAAAATTATACTTTTTGTGTTATTCTTGGTGATT
TATGCCATTACCTTACTGGGAAATATGGTTATGATCTTCATAATCCAAATAACTCCCAAG
CTCCACACACCCATGTACCTTTTCCTCAGCTGCCTTTCATTTGTAGATGCCTGCTATTCA
TCTGCAATTGCACCAAAAATGTTGGTCAACCTTCTAGTTGTGAAGGGAACCATTACTTTC
TCTGCCTGTATGGTACAACATTTGTGTTTTGGGGTGTTTGTTACCACAGAAGGCTTCTTG
TTGTCAGTGATGGCATATGACCGTTATGTGGCCATTGTCAACTCTTTGCTTTACAGTGCA
GCCATGTCTAAGAGGAAGTGTGTAGGGTGGGTCAATGGATCTTGGATATGTGGAATAATT
AACTCATTAATACACACAATAAGCTTAGGCAGACTGTCCTTCTGTGGGTCCAATGTTGTT
AACCACTTCTTCTGTGATATTCCCTCACTCCTAAAGCTATCATGTTCTGATACTACCATG
AATGAATTGTTGCTCTTAACTTTCTCTGGAGTCATTGCCATGGCCACCTTCTTGATTGTG
ATCATTTCCTACGTGTTTATTGCTGTTGCTATTCTGAGGATCCGCTCAGCAGCAGGCAGA
CAGAAAGCCTTCTCCACGTGTGCCTCCCACCTGACTGCTGTGACCATATTCTATGGTACT
TTAAGCTTTAGCTACATCCAGCCAAGTTCCCAGTATTTTGTGGAGCAGGAGAAGGTGGTG
TCTGTGTTCTATACACTAGTGATTCCCATGTTAAACCCACTTATTTACAGTCTGAGGAAC
AAAGAGGTAAAGGATGCTGTCAAAAGGGCCATCGAAATGACACATTTCCCTTGT


Conceptual translation

MRRNKQMAEENYTTVTEFILLGLTDLTDLKIILFVLFLVIYAITLLGNMVMIFIIQITPK
LHTPMYLFLSCLSFVDACYSSAIAPKMLVNLLVVKGTITFSACMVQHLCFGVFVTTEGFL
LSVMAYDRYVAIVNSLLYSAAMSKRKCVGWVNGSWICGIINSLIHTISLGRLSFCGSNVV
NHFFCDIPSLLKLSCSDTTMNELLLLTFSGVIAMATFLIVIISYVFIAVAILRIRSAAGR
QKAFSTCASHLTAVTIFYGTLSFSYIQPSSQYFVEQEKVVSVFYTLVIPMLNPLIYSLRN
KEVKDAVKRAIEMTHFPC