Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5K8 Olfactory Receptor

Gene Symbol OR5K8
Organism Dog
Family 5
Subfamily K
Pseudo No
Location chrUn_AAEX03022582:10136-11062 (+)
Aliases cOR5K8

Sequence information


Conceptual translation

MTEDNYSLTTEFILIGFTDHPKLKTVLFVVFLTIYLVTMVGNLGLVALILMERRLHTPMY
IFLGNLALMDSCCACAITPKMLENFFSKDRMISLYECMAQFYFLCLAETADCFLLAAMAY
DRYVAICSPLQYHTLMSKKLCLQMTAGAYIAGNLHSMIHIVFLFRLTFCRSHQINHFFCD
VLPLFKLSCVDPYINELLIFIFSGSVQVFSIIIVIISYLCILFMIFKMKSKEGRGKALST
CASHFLSVSMFYGSLLFVYVRPNSVKEEDKDIPVAIFYTLVIPLLNPFIYSLRNKEVINA
MKRNIKKIL