Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5M11 Olfactory Receptor

Gene Symbol OR5M11
Organism Dog
Family 5
Subfamily M
Pseudo No
Location chr18:39424000-39424965 (+)
Aliases cOR5M16, cOR5M16

Sequence information


Nucleotide sequence

ATGTCCATCACAAATGACAGTGCAATAAGAGAATTCATTCTCCTGGGGCTCACAGATCGT
CCCGAGCTCCAACCTCTCCTCTTTGTGCTGTTTCTGGGTGTGTACCTCGTCACCCTCTTG
GGCAACCTGGGCATGATGGTATTAATCAGGCTGGACTCCCGCCTTCACAAACCCATGTAC
TTCTTCCTCACTAATTTGGCCTTTGTAGACTTGTGCTACACCTCAAATGCAACCCCGCAG
ATGTTGACTAATTTTTTATCAGAGAAGAAGACCATCAGTTTTGCTGGCTGCTTTACGCAG
TGTTACATTTTCATTGCACTTCTCCTCACTGAGTTTTACATGCTGGCAGCAATGGCCTAT
GACCGCTATGTGGCCATATGTAACCCTCTACATTATAGTATGAAAATGTCCAGGCGTGTC
TGCATCGGCTTGGCCACATTTCCTTATGTCTATGGATTCTCAGATGGGCTCTTGCAGGCT
ATCCTGACCTTTCGCTTGAACTTCTGTAGATCCAATGTCATCAACCACTTCTACTGTGCT
GACCCGCCACTGATTAAGCTTTCTTGCTCTGATACTTATGTCAAAGAGCATGCCATGCTC
ATATCAGCTGGCTTCAACCTCTCCAACTCCCTCAGCATCATCCTGGTATCCTATGCTTTC
ATTATTGCTGCCATCCTCCGGATCAAATCAGCAGAGGGAAGACAGAAGGCATTCTCCACC
TGTGGTTCCCACATGATGGCTGTGACCTTATTTTATGGGACGCTCTTCTGCATGTATGTA
AGACCACCAACAGATAAGACTGTCGAGGAATCCAAAATCATAGCAGTCTTCTACACTTTT
GTGAGTCCAGTGCTTAATCCACTGATATACAGTCTGCGGAACAAAGATGTAAAGCAAGCC
TTGAAGAATGTCCTCAGAAGAAATATGATCATTAAGATGAGACTGCCTCCAGTTTCCAAT
AAATCA


Conceptual translation

MSITNDSAIREFILLGLTDRPELQPLLFVLFLGVYLVTLLGNLGMMVLIRLDSRLHKPMY
FFLTNLAFVDLCYTSNATPQMLTNFLSEKKTISFAGCFTQCYIFIALLLTEFYMLAAMAY
DRYVAICNPLHYSMKMSRRVCIGLATFPYVYGFSDGLLQAILTFRLNFCRSNVINHFYCA
DPPLIKLSCSDTYVKEHAMLISAGFNLSNSLSIILVSYAFIIAAILRIKSAEGRQKAFST
CGSHMMAVTLFYGTLFCMYVRPPTDKTVEESKIIAVFYTFVSPVLNPLIYSLRNKDVKQA
LKNVLRRNMIIKMRLPPVSNKS