Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5M12 Olfactory Receptor

Gene Symbol OR5M12
Organism Dog
Family 5
Subfamily M
Pseudo No
Location chr18:39,387,200-39,388,200 (-)
Aliases cOR5M12

Sequence information


Nucleotide sequence

ATGAAGATGGACATATTTCTCCCACACAACAGCACTGAAGCAACTGAGTTCATCCTGCTG
GGACTGACCAGCCAACAAGAGCTGCAACCCATCCTTTTTGTGGTGTTTCTACTGATTTAC
ATCATCACCCTGACAGGAAACTTTGGATTGATTGCATTAATCAGATTCACTCCCCGGCTG
CAAACACCCATGTACTTTTTCCTCACCCACTTAGCATGCGTGGATATTTTTTATTCTACT
AATGTCTCTCCTCAGATGCTTGTTAATTTCCTCTCTGAGAAGAAAACTATTTCCTACACA
GGGTGTCTGGCCCAGTGTTTTGTTTTTGTGACTCTGCTCCTTACTGAGTATTACATGCTT
GGTGCCATGGCCTATGACAGGTACATGGCAATCTGCCATCCGCTGCATTACAACAGCAGA
ATGTCCAGGCCACTTTGCATCTGCCTTGTCACTTTTCCCTACCTCTGGGGTTCTATGGTG
GGCACAATGCAAGTAATATTGACCTCTCGCTTGTCCTTTTGTGGACCTAACATCATCAAT
CATTTCTACTGTGCTGACCCACCTCTCCTCATGCTGACGTGTTCTGACACTTACATAAAG
CAGACTGCACTATTTGTGTCTGCGGGGATTAACCTCACTGGTTCCCTACTCATCATCCTC
ATCTCTTATGTTTTCATTTTTATCACCATTATGAGGATCCATTCCAGTGAAGGGCAATGC
AAAGCCTTCTCCACCTGTGGCTCTCACCTGACCGCTGTCACCATGTTCTATGGGTCCCTA
TTCTGCATGTATCTGAGACCAGCAAATGAGCAGTCTGTTGAACAAGGGAAAATTGTGGCA
GTGGTCTGTATCTTTGTGAGTCCCATGTTGAACCCATTTATCTACAGCCTGAGGAACAAA
GATGTGAAGCAGGCTTTGAGAATAGTATTTACGAGGAAACTTGGTACAGTGGAGAAAATG
TCTATTTTGACAGTCTCCCAA


Conceptual translation

MKMDIFLPHNSTEATEFILLGLTSQQELQPILFVVFLLIYIITLTGNFGLIALIRFTPRL
QTPMYFFLTHLACVDIFYSTNVSPQMLVNFLSEKKTISYTGCLAQCFVFVTLLLTEYYML
GAMAYDRYMAICHPLHYNSRMSRPLCICLVTFPYLWGSMVGTMQVILTSRLSFCGPNIIN
HFYCADPPLLMLTCSDTYIKQTALFVSAGINLTGSLLIILISYVFIFITIMRIHSSEGQC
KAFSTCGSHLTAVTMFYGSLFCMYLRPANEQSVEQGKIVAVVCIFVSPMLNPFIYSLRNK
DVKQALRIVFTRKLGTVEKMSILTVSQ