Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5M13 Olfactory Receptor

Gene Symbol OR5M13
Organism Dog
Family 5
Subfamily M
Pseudo No
Location chr18:39412932-39413864 (+)
Aliases cOR5M13, cOR5M13

Sequence information


Nucleotide sequence

ATGTTAAAGAACAACTACACAGCAGTGACTGAGTTTATTCTCCTGGGACTGACAGATCGA
GCTGAGTTGCAGCCTGTCCTTTTTGTGGTCTTCCTAGTCATCTACCTTATCACAGTGCTT
GGCAATGTTAGCATGATCTTGTTAATCAGAAGTGACTCAAAACTTCACACTCCGATGTAC
TTCTTCCTCAGTCATCTCTCTTTTGTGGACCTCTGTTATACCACCAATGTCTCTCCACAG
ATGCTGGTTCATTTCTTATCCGAGAGAAAAGCCATTTCCTTCCTGGGTTGCCTTCTGCAA
TTCCACTTTTTCATTGCCCTGGTGATCACCGATTATTATATGCTCACAGTGATGGCCTAT
GACCGCTACGTGGCCATCTGCAAACCCCTGTTGTATGGCAGCAAGATGTCCAGGTGTGTC
TGCTTCTCTCTCGTTGCCACCCCTTATATTTATGGCTTTGTGAATGGTCTGGCACAGACC
ATCCTGATGCTTCGCCTCTCCTTCTGTGGACCCAATGAAATCAACCACTTTTACTGTGCA
GACCCACCTCTCATAGTCCTTGCCTGCTCAGATACTTATGTCAAAGAAACTGCCATGTTT
GTGGTGGCTGGTTTCAATCTCACCTGTTCTCTAGCCATCATTCTCATCTCATACATTTTC
ATTTTCTCCACCATTCTGCGCATCCACTCTGCTGAGGGCAGGCGCAAAGCCTTCTCCACC
TGTGGGTCCCATTTGACGGCTGTCACCATCTTTTATGGGACTCTGTTCTGCATGTACCTG
AGACCTCCTTCTGAGACATCTGTAGAACAGAGCAAAATTGTTGCCGTGTTTTATATCTTT
GTGAGTCCTATGTTAAACCCTTTTATTTATAGCCTGCGGAACAAAGATGTTAAAAATGCA
ATCAGGAAAGTTTTCCAAAGGAAATTGTTAAAT


Conceptual translation

MLKNNYTAVTEFILLGLTDRAELQPVLFVVFLVIYLITVLGNVSMILLIRSDSKLHTPMY
FFLSHLSFVDLCYTTNVSPQMLVHFLSERKAISFLGCLLQFHFFIALVITDYYMLTVMAY
DRYVAICKPLLYGSKMSRCVCFSLVATPYIYGFVNGLAQTILMLRLSFCGPNEINHFYCA
DPPLIVLACSDTYVKETAMFVVAGFNLTCSLAIILISYIFIFSTILRIHSAEGRRKAFST
CGSHLTAVTIFYGTLFCMYLRPPSETSVEQSKIVAVFYIFVSPMLNPFIYSLRNKDVKNA
IRKVFQRKLLN