Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5M8 Olfactory Receptor

Gene Symbol OR5M8
Organism Dog
Family 5
Subfamily M
Pseudo No
Location chr18:39449735-39450667 (+)
Aliases cOR5M8, cOR5M8

Sequence information


Nucleotide sequence

ATGAGAAGAAACTTCACCTCAGTGACTGAGTTCATTCTCCTCGGACTGACCAGTCGCCTG
GAGTTGCAGATCGTCCTCTTCCTGCTGTTTCTGGCCATTTACTTGGTCACCCTCGCAGGG
AATCTTGGCATGATTGTACTCATCCAGGTCAATGCTCAGCTCCACAAGCCCATGTACTTT
TTCCTGAGCCACTTATCCTTTGTGGATCTGTGCTTCTCTTCCAACGTGACTCCCAAGATG
CTGGAGGTTTTCTTATCAGAGAAGAAAACCATTTCCTACCCTGCTTGTCTGGTGCAGTGT
TACTTCTTTATCACCTTGGTGCACGTGGAGATCTACATCCTGGCTGTGATGGCTTTTGAT
CGGTACATGGCCATCTGCAACCCTCTGCTTTATGGCAGCAAGATGTCCAAGAGTGTGTGC
ACATCCCTCATCACGGGGCCTTATGTGTACGGAGCACTCACTGGCCTCATGGAGACCATG
TGGACCTACAACCTAGTCTTCTGTGGCCCCAATGAAATTAACCACTTCTACTGTGCTGAC
CCACCACTGATTAAGCTGGCTTGTTCTGACACTTACAACAAAGAGCTGTCAATGTTTGTT
GTGGCAGGATGTAACCTTTCCTTTTCTCTGCTCATCATCCTGATTTCCTACCTTTATATT
GTTCCTGCTATCCTGAAGATTCGTTCAACAGAAGGCAGGCATAAAGCTTTCTCTACCTGT
GGCTCCCATCTGACAGCTGTCACCATATTCTATGCAACTCTTTTCTTCATGTATCTCAGA
CGCCCCTCAAAGGAATCTGTGGAACAGGGAAAAATGGTAGCTGTATTTTATACAACGGTA
ATCCCCATGCTGAACCCCATGATTTATAGCCTTAGGAATAAAGATGTGAAAGAAGCATTA
ACCAAAGAGTTGTTAGGAAACAAAAGGTTTTCT


Conceptual translation

MRRNFTSVTEFILLGLTSRLELQIVLFLLFLAIYLVTLAGNLGMIVLIQVNAQLHKPMYF
FLSHLSFVDLCFSSNVTPKMLEVFLSEKKTISYPACLVQCYFFITLVHVEIYILAVMAFD
RYMAICNPLLYGSKMSKSVCTSLITGPYVYGALTGLMETMWTYNLVFCGPNEINHFYCAD
PPLIKLACSDTYNKELSMFVVAGCNLSFSLLIILISYLYIVPAILKIRSTEGRHKAFSTC
GSHLTAVTIFYATLFFMYLRRPSKESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAL
TKELLGNKRFS