Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5T1 Olfactory Receptor

Gene Symbol OR5T1
Organism Dog
Family 5
Subfamily T
Pseudo No
Location chr18:39732423-39733406 (+)
Aliases cOR5T5, cOR5T5

Sequence information


Nucleotide sequence

ATGCCAGGATTTCCATCAGATTTAGATTTATACAGGATTCAGATGAAAAATGTGACTGAG
GCCACCATGTTTATATTGATGGGCTTCACAGATGATTTTGAGATGCAGGTCTTCCTATTT
TTACTATTTCTAGCAATCTATCTTTTTACTCTGATAGGAAACTTGGGACTGGTTATATTG
GTGATGGGGGAATCTCGGCTCCACAACCCCATGTATTATTTTCTGAGCGTTTTATCATTC
CTGGATGCCTGCTATTCTTCAGTTGTCACCCCAAAAATGTTGGTCAATTTCCTAGCAGAG
GATAAATCCATTTCCTATCTCGGATGTGCAGCACAGATGCTTCTCTTCGTTACTTTTGGA
ACCACAGAATGCTTTCTCTTGGCTGCCATGGCTTATGACCGCTATGTAGCAATCTACAAC
CCTCTCCTGTATTCCGTGAGCATGTCACCCAGGGTCTATGTGCCACTCATCGTTGCTTCC
TATGTTGGTGGCATTTTGCATGCTTCTGTACACACAGTGGCCACGTTCAGCCTATCCTTC
TGTGCTTCCAATGAAATTAGACATGTCTTTTGTGACATCCCTCCACTACTTGCCATTTCG
TGTTCTGACACCCACACAAACCAGCTGCTGCTCTTCTACTTCGTGGGCTCTATTGAGATA
GTCACTATCCTCATTGTTCTGATCTCCTATGGTTTCATTCTCTTGGCCATTCTGAACATC
CATTCTGCCGAGGGGAGGCGGAAAGTCTTTTCTACGTGTGGTTCTCACCTAACTGGAGTG
TCAATTTATCATGGAACCATCCTTTTCATATATATGAGACCAAGTTCCAGTTATGCTTTG
GAGCATGACATGATAGTGTCAATATTTTACACGATTGTGATTCCTATGCTGAATCCCATC
ATCTACAGTTTAAGGAACAAAGATGTAAAAGAGGCGATGAAGAAATTGTTTATGAGAAAT
TGGTTCTTAAGTAAAACACATAAT


Conceptual translation

MPGFPSDLDLYRIQMKNVTEATMFILMGFTDDFEMQVFLFLLFLAIYLFTLIGNLGLVIL
VMGESRLHNPMYYFLSVLSFLDACYSSVVTPKMLVNFLAEDKSISYLGCAAQMLLFVTFG
TTECFLLAAMAYDRYVAIYNPLLYSVSMSPRVYVPLIVASYVGGILHASVHTVATFSLSF
CASNEIRHVFCDIPPLLAISCSDTHTNQLLLFYFVGSIEIVTILIVLISYGFILLAILNI
HSAEGRRKVFSTCGSHLTGVSIYHGTILFIYMRPSSSYALEHDMIVSIFYTIVIPMLNPI
IYSLRNKDVKEAMKKLFMRNWFLSKTHN