Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5T2 Olfactory Receptor

Gene Symbol OR5T2
Organism Dog
Family 5
Subfamily T
Pseudo No
Location chr18:39711400-39712317 (-)
Aliases cOR5T7, cOR5T7

Sequence information


Nucleotide sequence

ATGAAAAATGTCACTGAAGTTACTACATTTGTACTAAAGGGCTTCACAGACAAACTTGAG
CTACAAATCATCTTATTCTTCCTGTTTCTAACAATCTATGTCTTTACTCTGATGGGAAAT
TTAGGACTGGTTGCATTGGTCATTGGGGATTCCCGGCTCCACAACCCCATGTACTATTTT
CTGAGTGTATTATCATCTGTGGATGCCTGCTATTCTTCAGTAATTACTCCAAATATGCTA
GTAGATTTTATGTCAAAGAATAAAGTCATTTCATTCCTTGGATGTGCAGCACAGATGTTT
CTCGCTGTTACTTTTGGGACCACAGAATGCTTTCTCTTGGCCGCCATGGCTTATGATCGC
TATGTAGCAATCTACAACCCTCTCCTATATTCTGTGAGCATGTCGCCCAGAGTCTATGTG
CCACTCATCATTGCTTCCTATGTTGGTGGCATTTTGCATGCTTCTGTACACACAGTGGCC
ACGTTCAGCCTATCCTTCTGTGCTTCAAATGAAATTAGACATGTCTTTTGTGACATCCCT
CCACTACTTGCTATTTCTTGTTCTGACACCCACACAAACCAGCTACTGCTCTTCTATTTT
GCGGGATCTATTGAGATAACTACTATACTGGTAGTCCTGATCTCCTATGGTTTCATTGTC
TTGGTAATTCTGAGGATGCATTCTGCTGAAGGCAGACGAAAAATCTTTTCTACATGTGGC
TCTCACTTAACTGGAGTGTCAATCTTTCATGGTACAGTTCTCTTCATGTATGTGAGACCA
AGTTCCAGCTATGCCCTGGACCATGACATGATAGTGTCAATATTTTACACGATTGTGATT
CCCATGCTGAATCCTATCATCTATAGTTTGAGGAACAAAGATGTAAAAGATGCAATGCAG
AAAGTGTTTAGGAAAAAT


Conceptual translation

MKNVTEVTTFVLKGFTDKLELQIILFFLFLTIYVFTLMGNLGLVALVIGDSRLHNPMYYF
LSVLSSVDACYSSVITPNMLVDFMSKNKVISFLGCAAQMFLAVTFGTTECFLLAAMAYDR
YVAIYNPLLYSVSMSPRVYVPLIIASYVGGILHASVHTVATFSLSFCASNEIRHVFCDIP
PLLAISCSDTHTNQLLLFYFAGSIEITTILVVLISYGFIVLVILRMHSAEGRRKIFSTCG
SHLTGVSIFHGTVLFMYVRPSSSYALDHDMIVSIFYTIVIPMLNPIIYSLRNKDVKDAMQ
KVFRKN