Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5T2B Olfactory Receptor

Gene Symbol OR5T2B
Organism Dog
Family 5
Subfamily T
Pseudo No
Location chr18:39,752,200-39,753,100 (+)
Aliases cOR5T6

Sequence information


Nucleotide sequence

ATGAAGAATGCTACAGAAGTCACCATATTTGTACTGAAGGGCTTCACAGATAAGCTTGAG
CTGCAAACAGCCTTGTTCTTCCTGTTTCTAGCAACCTACCTCTTTACTATGATGGGAAAT
TTGGTTTTAGTTTTGTTGGTCATTGTAGATTCCCAGCTCCACAACCCCATGTACTATTTT
CTGAGTGTGTTATCATCTGTGGATGCCTGCTTTTCCTCCGTAATTACTCCAAATATGTTA
GTAGATTTTATGTTAAAGAATAAAGTCATTTCATTCCTTGGATGTGCAGCACAGATGTTT
CTTGCTGTTACTTTTGGAACCACAGAATGCTTTCTCTTGGCTGCCATGGCTTATGACCGC
TATGTAGCAATCTACAACCCTCTCCTGTATTCTGTGGGCATGTCACCCAGGGTCTATGTG
CCACTCATCGTTGCTTCCTATGTTGGTGGCATTTTGCATGCTTCTGTACACACAGTGGCC
ACGTTCAGCCTATCCTTCTGTGCATCCAATGAAATTAGACATGTCTTTTGTGACATCCCT
CCACTACTTGCCATTTCGTGTTCTGACACCCACACAAACCAGCTGCTGCTCTTCTACTTC
GTGGGCTCTATTGAGATAGTCACTATCCTCATTGTTCTGATCTCCTATGGTTTCATTGTC
TTGGCCATTCTGAACATTCATTCTGCTGAGGGGAGGTGGAAAGTCTTTTCTACGTGTGGT
TCTCACCTAACTGGAGTGTCAATTTATCATGGAACCATCGTTTTCATGTATGTGAGACCA
AGTTCCAGCTATGCTCCAGACCATGACATGATAGTTTCAATGTTTTATAGCATTGTGATT
CCCATGCTGAATCCCATCATCTACAGTTTAAGGAACAAAGATGTAAAAGAGGCAATGAAA
AGAATGTTTCAGAAAAAATGGTTTATTAATTCATAC


Conceptual translation

MKNATEVTIFVLKGFTDKLELQTALFFLFLATYLFTMMGNLVLVLLVIVDSQLHNPMYYF
LSVLSSVDACFSSVITPNMLVDFMLKNKVISFLGCAAQMFLAVTFGTTECFLLAAMAYDR
YVAIYNPLLYSVGMSPRVYVPLIVASYVGGILHASVHTVATFSLSFCASNEIRHVFCDIP
PLLAISCSDTHTNQLLLFYFVGSIEIVTILIVLISYGFIVLAILNIHSAEGRWKVFSTCG
SHLTGVSIYHGTIVFMYVRPSSSYAPDHDMIVSMFYSIVIPMLNPIIYSLRNKDVKEAMK
RMFQKKWFINSY