Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5T8 Olfactory Receptor

Gene Symbol OR5T8
Organism Dog
Family 5
Subfamily T
Pseudo No
Location chr18:39,866,500-39,867,500 (-)
Aliases cOR5T8

Sequence information


Nucleotide sequence

ATGTCAGCAGTGCTGTCAGATTCAGATTTGTGCAGGGTTCAGATGGAAAATGTGACTGAA
GTCACCACGTTTATATTGACGGGCTTCACAGATGATTTTAAACTGCAAGTTTTCCTATTT
TTACTATTTCTAGCAATCTACCTTTTTACAATGATAGGAAATTTGGGAATGGTTTTATTG
GTCCTTGGGGATTCTCGGCTCCACAACCCCATGTATTATTTTCTGAGCGTGTTATCATTC
CTGGATGCCTGTTATTCTTCAGCTGTTACTCCAAAAATGTTAGTCAATTTCCTAGCAGAG
GATAAAACCATTTCATTCCTTGGATGTGCAGCACAGATGTTTCTCTTTATTTCTTTTGGG
ACCACAGAATGCTTTATTTTAGCTGCAATGGCATATGATCGCTACGAAGCGATCTACAAC
CCTCTCCTGTATTCAGTTCGAATGTCACCCAGAGTCTATGTGCCACTCATAATTTCCTGC
TATGTATGTGGATTCCTGCATGCTACTTTACACACTGTGGCTACTTTTACTCTATCCTTT
TGTGCATCCAATGAAATTAGACATGTCTTTTGTGACATCCCTCCTCTCCTTGCCATTTCT
TGTTCTGACACCCACACAAACCAGCTGCTAGTCTTCTACTTTGCGGGATCTATTGAGATA
TCCACTATTCTGATAGTCCTGGTCTCTTATGGTTTCATTCTGGTGGCCATTATGAGGGTG
CATTCTGCTGAAGGGAGGCGGAAAGTCTTTTCTACATGTGGCTCTCACTTAACTGGAGTG
TCAATTTTTCATGGTACGGTTCTCTTCATGTATGTGAGACCCAATTCCAGCTATGCTTTG
GATCATGATATGATAGTGTCAGTATTTTACACAATTGTGATTCCCATGCTGAATCCTATC
ATCTATAGTTTGAGGAACAAAGATGTGAAAGATGCAGTGAAAAGGGTATTTGGTAAAAAC
TGGTTTGCCAAT


Conceptual translation

MSAVLSDSDLCRVQMENVTEVTTFILTGFTDDFKLQVFLFLLFLAIYLFTMIGNLGMVLL
VLGDSRLHNPMYYFLSVLSFLDACYSSAVTPKMLVNFLAEDKTISFLGCAAQMFLFISFG
TTECFILAAMAYDRYEAIYNPLLYSVRMSPRVYVPLIISCYVCGFLHATLHTVATFTLSF
CASNEIRHVFCDIPPLLAISCSDTHTNQLLVFYFAGSIEISTILIVLVSYGFILVAIMRV
HSAEGRRKVFSTCGSHLTGVSIFHGTVLFMYVRPNSSYALDHDMIVSVFYTIVIPMLNPI
IYSLRNKDVKDAVKRVFGKNWFAN