Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5W1 Olfactory Receptor

Gene Symbol OR5W1
Organism Dog
Family 5
Subfamily W
Pseudo No
Location chr18:***************** (+)
Aliases cOR5W4, cOR5W4

Sequence information


Nucleotide sequence

ATGGCTGTTGAGAACTGCACTGTGATTACTGATTTCATACTCCTAGGACTTTCTGGCAGA
AAAGATGTGCAGCAGGGGCTCTTTGTGCTCTTTCTGCTAGTTTACAGCACAACCATGATT
GCCAATCTAGGGATGATCCTGCTGATCAAGCTGGACTCCAGGCTCCACACGCCCATGTAT
TATTTCCTGAGCAACCTGTCTCTCTGTGACGTCTGCTACTCCTCCACTGTCTCTCCCAAG
ATGCTGGCTGACTTCTTGTCTGAGCAAAAGAGAATTCCATATGATTTATGTGCAATTCAG
ATGTATTTTTTTGGGGTCTTTGCAGATGTGGAGTGTCTCATGTTGGCTGTCATGGCTTAT
GACCGGTATGTAGCCATTTGTAATCCACTTCTTTATACAATCGCCATGTCCAGGCAAATC
TGCATCCAGCTTGTGTCCCTTGCCTACATCGTCGGTTTTGTGGATTCAGCAATCCACACC
TGCTGCACATTTCGATTGTCGTTCTGCGATTCCAATATCATCAATCACTTTTTCTGTGAC
ATCCCACCCTTGCTAGCCCTTTCCTCTTCAGATACATCCATCAATGAGATAGTGATGTTC
ACTTTCATTGGTTGTGTAGTGGGCTGCAGCATCATCACTGTTCTCCTCTCCTACAGCTAT
ATCCTAACTACCATCCTTAGAATGAACTCAGCTGAAGGGAGACGCAAAGCCTTCTCTACA
TGTGCCTCCCACTTGACCGCAGTGGCTATATTTCACGGCACACTTCTGTTCATGTATTTC
CGACCGAGCTCCAGTTACTCAATGGACACAGACAAAATGTCTTCTGTCTTCTACACTGTG
GTCATCCCTATGTTAAACCCACTCATCTACAGCTTAAGGAATAAGGATGTGAAAGGTGCC
CTGAAAAAAGCAATCAGCACTAAATTATGTTCTGGG


Conceptual translation

MAVENCTVITDFILLGLSGRKDVQQGLFVLFLLVYSTTMIANLGMILLIKLDSRLHTPMY
YFLSNLSLCDVCYSSTVSPKMLADFLSEQKRIPYDLCAIQMYFFGVFADVECLMLAVMAY
DRYVAICNPLLYTIAMSRQICIQLVSLAYIVGFVDSAIHTCCTFRLSFCDSNIINHFFCD
IPPLLALSSSDTSINEIVMFTFIGCVVGCSIITVLLSYSYILTTILRMNSAEGRRKAFST
CASHLTAVAIFHGTLLFMYFRPSSSYSMDTDKMSSVFYTVVIPMLNPLIYSLRNKDVKGA
LKKAISTKLCSG