Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR5W6 Olfactory Receptor

Gene Symbol OR5W6
Organism Dog
Family 5
Subfamily W
Pseudo No
Location chr18:40,038,200-40,039,200 (+)
Aliases cOR5W6

Sequence information


Nucleotide sequence

ATGGATGGAAAAAATTGCTCTTCCGTGAATGAATTCCTTCTCGTGGGAATTAGCAATAAG
CCTGGAGTTAAAGTGACTCTGTTTATCACATTTCTAATTATCTATCTCATCATTCTTGTT
GCAAACCTCGGGATGATCATTTTAATCAGGATGGACTCCCAGCTTCACACACCCATGTAT
TTCTTCCTGAGCCATCTCTCCTTCAGTGACGTCTGCTATTCTACAGCAGTCGGACCCAGG
ATGCTGGTAGGCTTCATTGCCAAGAACAAGTCAATTTCCTTCTACAGCTGTGCTCTGCAA
TTCTTGATCTTCTGTATTTTTGCAGATTCTGAGTGTCTACTGCTGGCAGTGATGGCCTTT
GATCGGTACAAAGCCATTAGCCACCCCTTGCTCTATACAGTCAGCATGTCCAGCAGAGTG
TGCTCCCTGCTGATGGCTGGGGTTTACATGGTGGGAATTATGGATGCTTCAGTAAATACA
ATATTAACATTCCGGTTATGTTTCTGTGAGTCGAATGTGATTAACCATTTCTTCTGTGAT
GTCCCACCTCTCCTCTTGTTATCTTGCTCAGACACACAAGTTAATGAGTTAGTGATATTC
ACCATTTTTGGCTTCATTGAACTGATTACTCTTTCAGGGCTTTTTGTGTCTTACTGCTAT
ATTATCCTAGCGGTGAGAAAGATCAACTCTGCTGAGGGGAGGTTCAAAGCTTTCTCCACC
TGCACCTCCCACTTAACTGCTGTTGCAATTTTCCAGGGAACTCTGCTCTTTATGTATTTC
CGGCCAAGCTCTTCCTACTCCCTTGATCAAGACAAAATTACTTCATTGTTTTACTCCCTT
GTGATTCCCATGCTAAACCCTCTGATTTATAGCCTACGGAACAAGGATGTGAAAGAGGCC
CTGAAGaaacttaaaaaaaacttaaacttaaaaaataaactaaaaaaaaaactaaaaaaa
attttaaaaact


Conceptual translation

MDGKNCSSVNEFLLVGISNKPGVKVTLFITFLIIYLIILVANLGMIILIRMDSQLHTPMY
FFLSHLSFSDVCYSTAVGPRMLVGFIAKNKSISFYSCALQFLIFCIFADSECLLLAVMAF
DRYKAISHPLLYTVSMSSRVCSLLMAGVYMVGIMDASVNTILTFRLCFCESNVINHFFCD
VPPLLLLSCSDTQVNELVIFTIFGFIELITLSGLFVSYCYIILAVRKINSAEGRFKAFST
CTSHLTAVAIFQGTLLFMYFRPSSSYSLDQDKITSLFYSLVIPMLNPLIYSLRNKDVKEA
LKKLKKNLNLKNKLKKKLKKILKT