Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6AA1 Olfactory Receptor

Gene Symbol OR6AA1
Organism Dog
Family 6
Subfamily AA
Pseudo No
Location chr8:737285-738223 (+)
Aliases cOR6AA1

Sequence information


Nucleotide sequence

ATGGATATAACAAACCAAACAAGAGTGACAGAGTTCATTTTTCTTGGGTTTCCTGGTGTT
CTACATCTGCGGATCACCTTGTTTGTGATATTTCTTACTGTATATCTACTCTCCCTCACA
GGAAACACTCTCATTATTTTCATTGTTCTCATGGATATCACACTCCAAACGCCCATGTAC
ATTTTCTTAGGAAATTTGTCATTCCTGGAGATCTGGTACACCACAGCCACGGTGCCTAAA
TTGCTGGACACCTGCCTCTCACAGGTTGTTACCATCTCTGTTTCTGGTTGTATCACCCAG
TACTACTTCTTTTTCTCCATGGGAGCTACAGAGTGCATCCTGCTGGCAGTGATGGCCTAT
GATCGGTACCTGGCCATCTGCAGCCCTTTAAGATACTCACTTCTCATGAGTATTCGTGTG
TGCCTGCGGTTTTCAGCTGGATCTTGGATTGGGGGCTTCATTGCCCCTCTCTTACCTACC
ATACTCATTTCTCATCTAAATTTCTGTGGCCCCCAGAAGATCAGCCATTTCTTTTGTGAC
TCAGACCCCATTTTCAAACTCTCCTGCTCAGATACATTTTTGGTGGAGGCTTTGGGCTAC
ACATGTAGCTCTGTTGTGATTCTAAGTTCTTTCCTTCTCACCATGTCTTCCTATGGACAC
ATCGTGGTCACAATAATCAAGCTGTCTTCCAGGGAGGCTCGGAAGAAAACTTTCTCCACC
TGTGCCTCCCACCTCACTGTGGTCTCTATCTATTATGGCACCATTATCTTTGCCTATGTT
CGCCCTCCAGCCAAGTACAATTTCACCATTGGTAAAGTGATATCAGTGTTCTACTGTGTG
GTTACCCCTTTGGTAAATCCTCTAATATATACCCTGAGAAACAAAGATGTGAAGAAAGCT
TTCAGAAAAGCTCTAGCAAGAAAGAGAATGCTCTTGACC


Conceptual translation

MDITNQTRVTEFIFLGFPGVLHLRITLFVIFLTVYLLSLTGNTLIIFIVLMDITLQTPMY
IFLGNLSFLEIWYTTATVPKLLDTCLSQVVTISVSGCITQYYFFFSMGATECILLAVMAY
DRYLAICSPLRYSLLMSIRVCLRFSAGSWIGGFIAPLLPTILISHLNFCGPQKISHFFCD
SDPIFKLSCSDTFLVEALGYTCSSVVILSSFLLTMSSYGHIVVTIIKLSSREARKKTFST
CASHLTVVSIYYGTIIFAYVRPPAKYNFTIGKVISVFYCVVTPLVNPLIYTLRNKDVKKA
FRKALARKRMLLT